Citrus Sinensis ID: 012896


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450----
MAQVQAQGQNVNGGGANANQFGTTSLYVGDLEANVTDSQLYDLFNQMGQVVSVRVCRDLSTRRSLGYGYVNFSNAQEAARALEMLNFTPLNGKPIRVMYSHRDPSLRKSGAGNIFIKNLDKAIDHKALHDTFSAFGNILSCKVATDLNGQSKGYGFVQFDNEESAQKAIEKLNGMLLNDKQVYVGHFLRKQERDTEINKSKFTNVYVKNLSESTTEEDLQKSFGEYGTITSAVVMRDGDGKSKCFGFVNFENSDDAARAVEALNGKKFDDKEWYVGKAQKKSERELELKHQFEQNMKEAADKFQGANLYIKNLDDSIDDEKLKQLFSPFGSITSCKVMRDPSGISRGSGFVAFSTPEEASRALLEMNGKMVVSKPLYVALAQRKEDRRARLQAQFAQMRPVAMASTVAPRMPMYPPGAWIWLSAAACSWYEARWGSHAKFLCADSSARAAGSAS
ccccccccccccccccccccccccEEEEccccccccHHHHHHHHcccccEEEEEEEEcccccccccEEEEEcccHHHHHHHHHHHcccccccEEEEEEEccccccccccccccEEEccccccccHHHHHHHHHccccccEEEEEEccccccccEEEEECccHHHHHHHHHHHcccccccEEEEEEEcccccccccccccccccEEEEccccccccHHHHHHHHccccccEEEEEEEccccccccCEEEEcccHHHHHHHHHHHcccECccCEEEEEcccccHHHHHHHHHHHHHHHHHHHccccccEEEEEcccccccHHHHHHHHcccccEEEEEEEEccccccccCEEEEcccHHHHHHHHHHHcccEEccEEEEEEEEcccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
*********************GTTSLYVGDLEANVTDSQLYDLFNQMGQVVSVRVCRDLSTRRSLGYGYVNFSNAQEAARALEMLNFTPLNGKPIRVMYSHR***LRKSGAGNIFIKNLDKAIDHKALHDTFSAFGNILSCKVATDLNGQSKGYGFVQFDNEESAQKAIEKLNGMLLNDKQVYVGHFLRKQERDTEINKSKFTNVYVKNLSESTTEEDLQKSFGEYGTITSAVVMRDGDGKSKCFGFVNFENSDDAARAVEALNGKKFDDKEWYV***************************FQGANLYIKNLDDSIDDEKLKQLFSPFGSITSCKVMRDPSGISRGSGFVAFSTPEEASRALLEMNGKMVVSKPLYVALA*******************VAMASTVAPRMPMYPPGAWIWLSAAACSWYEARWGSHAKFLC************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAQVQAQGQNVNGGGANANQFGTTSLYVGDLEANVTDSQLYDLFNQMGQVVSVRVCRDLSTRRSLGYGYVNFSNAQEAARALEMLNFTPLNGKPIRVMYSHRDPSLRKSGAGNIFIKNLDKAIDHKALHDTFSAFGNILSCKVATDLNGQSKGYGFVQFDNEESAQKAIEKLNGMLLNDKQVYVGHFLRKQERDTEINKSKFTNVYVKNLSESTTEEDLQKSFGEYGTITSAVVMRDGDGKSKCFGFVNFENSDDAARAVEALNGKKFDDKEWYVGKAQKKSERELELKHQFEQNMKEAADKFQGANLYIKNLDDSIDDEKLKQLFSPFGSITSCKVMRDPSGISRGSGFVAFSTPEEASRALLEMNGKMVVSKPLYVALAQRKEDRRARLQAQFAQMRPVAMASTVAPRMPMYPPGAWIWLSAAACSWYEARWGSHAKFLCADSSARAAGSAS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Polyadenylate-binding protein 2 Binds the poly(A) tail of mRNA.probableP42731
Polyadenylate-binding protein 1-A Binds the poly(A) tail of mRNA. Appears to be an important mediator of the multiple roles of the poly(A) tail in mRNA biogenesis, stability and translation.probableQ54BM2
Polyadenylate-binding protein, cytoplasmic and nuclear Binds the poly(A) tail of mRNA. Appears to be an important mediator of the multiple roles of the poly(A) tail in mRNA biogenesis, stability and translation. In the nucleus, interacts with the nuclear cleavage factor IA (CFIA), which is required for both mRNA cleavage and polyadenylation. Is also required for efficient mRNA export to the cytoplasm. Acts in concert with a poly(A)-specific nuclease (PAN) to affect poly(A) tail shortening, which may occur concomitantly with either nucleocytoplasmic mRNA transport or translational initiation. Regulates PAN activity via interaction with the stimulator PAN3 or the inhibitor PBP1. In the cytoplasm, affects both translation and mRNA decay. Stimulates translation by interaction with translation initiation factor eIF4G, a subunit of the cap-binding complex eIF4F, bringing the 5'- and 3'-ends of the mRNA in proximity. The formation of this circular mRNP structure appears to be critical for the synergistic effects of the cap and the poly(A) tail in facilitating translation initiation, recycling of ribosomes, and mRNA stability. Also regulates translation termination by recruiting eukaryotic release factor 3 (eRF3). Interaction with eRF3 is also required for regulation of normal mRNA decay through translation termination-coupled poly(A) shortening, probably mediated by PAN. Loss of PAB1 from the mRNP after deadenylation triggers mRNA degradation. Inhibits the major cytoplasmic mRNA deadenylase CCR4-NOT complex. Is also associated peripherally with COPI vesicles through its interaction with ARF1, and this is required for correct localization of the asymmetrically distributed ASH1 mRNA.probableP04147

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4F02, chain A
Confidence level:very confident
Coverage over the Query: 23-193
View the alignment between query and template
View the model in PyMOL
Template: 1B7F, chain A
Confidence level:very confident
Coverage over the Query: 201-283,302-381
View the alignment between query and template
View the model in PyMOL
Template: 2YH0, chain A
Confidence level:very confident
Coverage over the Query: 202-385
View the alignment between query and template
View the model in PyMOL