Citrus Sinensis ID: 012902


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450----
MSLNVEISLILFSKISFSRSVFTKQFSVIDVLLKLKLKHNSYKQIISLCVGNFEQIFIVFGQVNMSIAILPMSAEFNWNPATVGLIQSSFFWGYLLTQIAGGIWADTVGGKAVLGFGVVWWSIATALTPVAAKLGLPFLLVVRVFMGIGEGVAMPAMNNILSKWVPVAERSRSLALVYSGMYLGSVTGLAFSPFLIHRFGWPSVFYSFGSLGTVWFTVWLSKAHSSPAEDPQLRPAEKKLIVSSCASKEPVKTIPWGLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYNQVLHFNLTESGLFCVLPWLTMAFSANLGGWIADTLVSKGLSVTTVRKIMQSIGFLGPAFFLTQLSHVDSPAMAVLCMACSQGTDAFSQSGLYSNHQDIAPRYSGVLLGLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTAVWNLFSTGEKVVD
cccHHHHHHHHHHHHccccEEEEEEHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHcccccHHHHHHHHHHccccccHHHHHHHHHHcHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHccccccccccccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccccccc
****VEISLILFSKISFSRSVFTKQFSVIDVLLKLKLKHNSYKQIISLCVGNFEQIFIVFGQVNMSIAILPMSAEFNWNPATVGLIQSSFFWGYLLTQIAGGIWADTVGGKAVLGFGVVWWSIATALTPVAAKLGLPFLLVVRVFMGIGEGVAMPAMNNILSKWVPVAERSRSLALVYSGMYLGSVTGLAFSPFLIHRFGWPSVFYSFGSLGTVWFTVWLSKAHSSPAEDP*LRP*****IVSSCASKEPVKTIPWGLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYNQVLHFNLTESGLFCVLPWLTMAFSANLGGWIADTLVSKGLSVTTVRKIMQSIGFLGPAFFLTQLSHVDSPAMAVLCMACSQGTDAFSQSGLYSNHQDIAPRYSGVLLGLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTAVWNLFSTGEKVV*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLNVEISLILFSKISFSRSVFTKQFSVIDVLLKLKLKHNSYKQIISLCVGNFEQIFIVFGQVNMSIAILPMSAEFNWNPATVGLIQSSFFWGYLLTQIAGGIWADTVGGKAVLGFGVVWWSIATALTPVAAKLGLPFLLVVRVFMGIGEGVAMPAMNNILSKWVPVAERSRSLALVYSGMYLGSVTGLAFSPFLIHRFGWPSVFYSFGSLGTVWFTVWLSKAHSSPAEDPQLRPAEKKLIVSSCASKEPVKTIPWGLILSKPPVWALIVSHFCHNWGTFILLTWMPTYYNQVLHFNLTESGLFCVLPWLTMAFSANLGGWIADTLVSKGLSVTTVRKIMQSIGFLGPAFFLTQLSHVDSPAMAVLCMACSQGTDAFSQSGLYSNHQDIAPRYSGVLLGLSNTAGVLAGVFGTAATGYILQHGSWDDVFKVSVGLYLVGTAVWNLFSTGEKVVD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Sodium-dependent phosphate transport protein 1, chloroplastic Specific for inorganic phosphate transport across the thylakoid membrane in a sodium dependent manner. Binds glutamate but cannot transport it.probableO82390
Probable anion transporter 1, chloroplastic Probable anion transporter.probableQ9SDI4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1PW4, chain A
Confidence level:very confident
Coverage over the Query: 42-447
View the alignment between query and template
View the model in PyMOL