BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 012908
         (453 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2UZF|A Chain A, Crystal Structure Of Staphylococcus Aureus
           1,4-Dihydroxy-2- Naphthoyl Coa Synthase (Menb) In
           Complex With Acetoacetyl Coa
 pdb|2UZF|B Chain B, Crystal Structure Of Staphylococcus Aureus
           1,4-Dihydroxy-2- Naphthoyl Coa Synthase (Menb) In
           Complex With Acetoacetyl Coa
          Length = 273

 Score = 28.5 bits (62), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 3/57 (5%)

Query: 8   FVGNNGETYFNTAALVSCVQNFPKSRGPVVGILKGFAGLGGAILTQVYTMIHAPDHA 64
           +VG +     N   L   ++  PK   PV+ ++KG+A  GG +L  V  +  A D+A
Sbjct: 85  YVGEDQIPRLNVLDLQRLIRIIPK---PVIAMVKGYAVGGGNVLNVVCDLTIAADNA 138


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.325    0.140    0.421 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 11,702,167
Number of Sequences: 62578
Number of extensions: 431031
Number of successful extensions: 1079
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1078
Number of HSP's gapped (non-prelim): 2
length of query: 453
length of database: 14,973,337
effective HSP length: 102
effective length of query: 351
effective length of database: 8,590,381
effective search space: 3015223731
effective search space used: 3015223731
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 53 (25.0 bits)