BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 012910
         (453 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2B7Y|A Chain A, Fava Bean Lectin-Glucose Complex
 pdb|2B7Y|C Chain C, Fava Bean Lectin-Glucose Complex
          Length = 182

 Score = 29.3 bits (64), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 28/66 (42%), Gaps = 5/66 (7%)

Query: 136 AHGMTFFNTADVVTSVRNFPTYSGTAVGIMKGSDSDRTSETSFCEEDELTDDPHEMHAEK 195
           A G TFF     +  V   P   G  +G+  G D D+T++T   E D   +   +    K
Sbjct: 81  ADGFTFF-----IAPVDTKPQTGGGYLGVFNGKDYDKTAQTVAVEFDTFYNAAWDPSNGK 135

Query: 196 MHVRQD 201
            H+  D
Sbjct: 136 RHIGID 141


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.324    0.138    0.432 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 13,296,537
Number of Sequences: 62578
Number of extensions: 536381
Number of successful extensions: 1367
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 1367
Number of HSP's gapped (non-prelim): 4
length of query: 453
length of database: 14,973,337
effective HSP length: 102
effective length of query: 351
effective length of database: 8,590,381
effective search space: 3015223731
effective search space used: 3015223731
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 53 (25.0 bits)