Citrus Sinensis ID: 012963

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450--

MFQALARDRLERLNASPSATPWTYFRVFSALLFVLAVDIFWIRMCLLLFKTLDSSMFLLLFFEPLSVAFETMQAILVHGFQLLDIWLHHSAGNSTNCARSKFFDTLAAGSLLEWKGILIRNFGFFLDMATLLMALGHYIHIWWLRGMAFHLVDAILFLNIRALLSAIIKRIKGFIKLRIALGHLHAALPDATSEELRAYDDECAICREPMAKAKKLLCNHLFHLACLRSWLDQGLNEMYSCPTCRKPLFVGRREIEANSRPGEVSSDEQLARQLSMGLDRQNNTGQTLPTGVFPNQTQPPVEGSPWRNAGLDSSWLHAWPSQGVDGAGPSTAMRSVGLSRVQMMMRHLASVGETYAQTAIEDTSWSLWPMNPSQASASGSPVPPAVPGRHPGNTGGAHARSTSRSANENIANILAMAETVREVLPHMPEDLIFQDLQRTNSATITVNNLLQM

ccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHccccccccccEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHccccccEEEcccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHcccccccccccccc

MFQALARDRLERLNASPSATPWTYFRVFSALLFVLAVDIFWIRMCLLLFKTLDSSMFLLLFFEPLSVAFETMQAILVHGFQLLDIWLHHSAGNSTNCARSKFFDTLAAGSLLEWKGILIRNFGFFLDMATLLMALGHYIHIWWLRGMAFHLVDAILFLNIRALLSAIIKRIKGFIKLRIALGHLHAALPDATSEELRAYDDECAICREPMAKAKKLLCNHLFHLACLRSWLDQGLNEMYSCPTCRKPLFV***************************************************************************************LSRVQMMMRHLASV*ETYAQTAIEDTSWSLW*****************************************IANILAMAETVREVLPHMPEDLIFQDLQRTNSATITVNNLLQM

xxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
E3 ubiquitin protein ligase RIN2	E3 ubiquitin protein ligase that acts as positive regulator of RPM1- and RPS2-dependent hypersensitive response (HR), in association with RIN3. Probably not required for RPM1 degradation during HR.	probable	Q8VYC8

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ECT, chain A
Confidence level:very confident
Coverage over the Query: 198-253
View the alignment between query and template
View the model in PyMOL

Template: 4G3O, chain A
Confidence level:very confident
Coverage over the Query: 410-451
View the alignment between query and template
View the model in PyMOL

Template: 3IHP, chain A
Confidence level:probable
Coverage over the Query: 206-217,240-316
View the alignment between query and template
View the model in PyMOL