BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 012967
(452 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2VJY|A Chain A, Pyruvate Decarboxylase From Kluyveromyces Lactis In
Complex With The Substrate Analogue Methyl
Acetylphosphonate
pdb|2VJY|B Chain B, Pyruvate Decarboxylase From Kluyveromyces Lactis In
Complex With The Substrate Analogue Methyl
Acetylphosphonate
pdb|2VJY|C Chain C, Pyruvate Decarboxylase From Kluyveromyces Lactis In
Complex With The Substrate Analogue Methyl
Acetylphosphonate
pdb|2VJY|D Chain D, Pyruvate Decarboxylase From Kluyveromyces Lactis In
Complex With The Substrate Analogue Methyl
Acetylphosphonate
pdb|2VK4|A Chain A, Crystal Structure Of Pyruvate Decarboxylase From
Kluyveromyces Lactis
pdb|2VK4|B Chain B, Crystal Structure Of Pyruvate Decarboxylase From
Kluyveromyces Lactis
pdb|2VK4|C Chain C, Crystal Structure Of Pyruvate Decarboxylase From
Kluyveromyces Lactis
pdb|2VK4|D Chain D, Crystal Structure Of Pyruvate Decarboxylase From
Kluyveromyces Lactis
Length = 563
Score = 28.5 bits (62), Expect = 8.7, Method: Compositional matrix adjust.
Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 2/47 (4%)
Query: 129 RGQKPLDPPARPKGDEREETATESLQ--LWTDSGESCPEGTVPIRRT 173
+G KP+ P+ P+ +E +T Q +WT GE EG V I T
Sbjct: 342 KGYKPVPVPSEPEHNEAVADSTPLKQEWVWTQVGEFLREGDVVITET 388
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.320 0.135 0.438
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 13,949,631
Number of Sequences: 62578
Number of extensions: 579455
Number of successful extensions: 1075
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 6
Number of HSP's that attempted gapping in prelim test: 1075
Number of HSP's gapped (non-prelim): 6
length of query: 452
length of database: 14,973,337
effective HSP length: 102
effective length of query: 350
effective length of database: 8,590,381
effective search space: 3006633350
effective search space used: 3006633350
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 53 (25.0 bits)