Citrus Sinensis ID: 013064


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450
MRAQQAAVSNEEQEEMLRNLERRETEYMRLQRRKIGIDDFEQLTLIGKGAFGEVRLCRAKTTGEIFAMKKLKKSEMLKRGQVEHVRSERNLLAEVDSRCIVQLFYSFQDSDFLYLIMEYLPGGDIMTLLMREDILSEDVARFYIAESVLAIHSIHQHNYVHRDIKPDNLILDKNGHLKLSDFGLCKPLEDKYSSILLEDEDIINQETVSEAEGQWMMPKERLQQWKRNRRALAYSTVGTLDYMAPEVLLKKGYGMECDWWSLGAIMYEMLIGYPPFCSDDPRITCRKIVNWKTCLKFPEEPKISDEARDLICHLLCDVETRLGTRGVEELKEHPWFRGIQWDKLYEMEAAYKPTVNGELDTQNFEKFPEVDGPPSEIPSVGPWRKMLTSKDTNFIGYTFKKSDVLKSLENSGTDMRSNGSSKVPSLISLLGRIDVQETAISECDQQKQET
cccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEccccCEEEEEEEcccccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHccccEEEcEEEEEcccccEEEEEccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHccccccccccccEEEcccccEEEcccccccccccccccccccccHHHcccccccccccccccHHHHHHHHHHccccccccccccccccHHHHcccccccccHHHHHHHHHHHHHccccccccccHHHHHHHHccccccccccccccccHHHHHHHHHHccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccHHHHHHHHHccc
***************************MRLQRRKIGIDDFEQLTLIGKGAFGEVRLCRAKTTGEIFAMKKLKKSEMLKRGQVEHVRSERNLLAEVDSRCIVQLFYSFQDSDFLYLIMEYLPGGDIMTLLMREDILSEDVARFYIAESVLAIHSIHQHNYVHRDIKPDNLILDKNGHLKLSDFGLCKPLEDKYSS**********************MPKERLQQWKRNRRALAYSTVGTLDYMAPEVLLKKGYGMECDWWSLGAIMYEMLIGYPPFCSDDPRITCRKIVNWKTCLKFPEEPKISDEARDLICHLLCDVETRLGTRGVEELKEHPWFRGIQWDKLYEMEAAYKPTVNGELDTQNFEKFP********************SKDTNFIGYTFKKS************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKIGIDDFEQLTLIGKGAFGEVRLCRAKTTGEIFAMKKLKKSEMLKRGQVEHVRSERNLLAEVDSRCIVQLFYSFQDSDFLYLIMEYLPGGDIMTLLMREDILSEDVARFYIAESVLAIHSIHQHNYVHRDIKPDNLILDKNGHLKLSDFGLCKPLEDKYSSILLEDEDIINQETVSEAEGQWMMPKERLQQWKRNRRALAYSTVGTLDYMAPEVLLKKGYGMECDWWSLGAIMYEMLIGYPPFCSDDPRITCRKIVNWKTCLKFPEEPKISDEARDLICHLLCDVETRLGTRGVEELKEHPWFRGIQWDKLYEMEAAYKPTVNGELDTQNFEKFPEVDGPPSEIPSVGPWRKMLTSKDTNFIGYTFKKSDVLKSLENSGTDMRSNGSSKVPSLISLLGRIDVQETAISECDQQKQET

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine/threonine-protein kinase tricorner Has an important role, with fry, in controlling cell structure and proliferation of a variety of polarized outgrowths including epidermal hairs, bristles, arista laterals, and dendrites. Affects cellular morphogenesis by regulating the expression of target genes that encode cytoskeleton-interacting proteins and not via the direct modification of the cytoskeleton. Maintains the integrity of epidermal hairs and is an essential component of the signaling pathway regulating dendritic branching of sensory neurons.probableQ9NBK5
Serine/threonine-protein kinase tricorner Has an important role, with fry, in controlling cell structure and proliferation of a variety of polarized outgrowths including epidermal hairs, bristles, arista laterals, and dendrites. Affects cellular morphogenesis by regulating the expression of target genes that encode cytoskeleton-interacting proteins and not via the direct modification of the cytoskeleton. Maintains the integrity of epidermal hairs and is an essential component of the signaling pathway regulating dendritic branching of sensory neurons.probableQ2LZZ7
Serine/threonine-protein kinase 38-like Involved in the regulation of structural processes in differentiating and mature neuronal cells.probableQ9Y2H1

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.11.-Protein-serine/threonine kinases.probable
2.7.11.1Transferred entry: 2.7.11.19.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2VD5, chain A
Confidence level:very confident
Coverage over the Query: 24-193,231-405
View the alignment between query and template
View the model in PyMOL
Template: 3RP9, chain A
Confidence level:very confident
Coverage over the Query: 37-199,238-346
View the alignment between query and template
View the model in PyMOL
Template: 3EQC, chain A
Confidence level:very confident
Coverage over the Query: 5-191,232-345
View the alignment between query and template
View the model in PyMOL
Template: 3NYN, chain A
Confidence level:confident
Coverage over the Query: 30-184,207-219,237-435
View the alignment between query and template
View the model in PyMOL