Citrus Sinensis ID: 013089

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------45

MEHKNVFCQRRRCHSFLELKFALLAIAFFMLSHAEAYDPLDPTGNVTIKWDVMSWTPDGYVAAVTINNFQMYRHIGAPGWTLGWQWAKKEVIWTMVGAQTTEQGDCSKFKANIPHCCKRTPIVVDLLPGVPYNQQFANCCKGGVLSAWGQDPASAVSAFQVSVGLAGTSNKTVKLPKNFTLQGPGPGYTCGPAKVVPSTVYLTSDRRRKTQALMTWNVTCTYSQFLASKNPSCCVSFSSFYNETITPCPSCACGCHNKNNCIMSNSKAAHRTGINTPKKDNTPLLQCTHHMCPIRVHWHVKVNYKEYWRVKIAITNFNYRMNYTQWTLVAQHPNLNNVTQVFSFDYKPLVPYESINDTGMFYGMKFYNDLLMEAGPQGNVQSELLLQKNKDTFTFKQGWAFPRKVYFNGDECMLPPPDTYPFLPNSANANPITSLTMAASVLLAVMSIW

ccccccEEECccHHHHHHHHHHHHHHHHHccccccccccccccccEEEEEEEEEEccccEEEEEEEEcccccccccccccEEEEEEcccEEEEEEcccCEECcccccccccccccccccccEEEEccccccccccccccccccEEccccccccccccEEEEEEcccccccccccccccEEEEcccccccccccEECcccccccccccEEEEEEEEEEEEEEEEccccccccccEEEEccECcccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEcccccEEEEEEEEEcccccccccHHHHHccccccccEEEEEEccccccccccccccEEEcccHHHHHHHHHccccccCEEEEEEEEcccccccccccccccEEEEccccccccccccccccccccccccHHHHHHHHHHHHHHHHHc

*****VFCQRRRCHSFLELKFALLAIAFFMLSHAEAYDPLDPTGNVTIKWDVMSWTPDGYVAAVTINNFQMYRHIGAPGWTLGWQWAKKEVIWTMVGAQTTEQGDCSKFKANIPHCCKRTPIVVDLLPGVPYNQQFANCCKGGVLSAWGQDPASAVSAFQVSVGLAGTSNKTVKLPKNFTLQGPGPGYTCGPAKVVPSTVYLTSDRRRKTQALMTWNVTCTYSQFLASKNPSCCVSFSSFYNETITPCPSCACGCHNKNNCIMSN*************KDNTPLLQCTHHMCPIRVHWHVKVNYKEYWRVKIAITNFNYRMNYTQWTLVAQHPNLNNVTQVFSFDYKPLVPYESINDTGMFYGMKFYNDLLMEAGPQGNVQSELLLQKNKDTFTFKQGWAFPRKVYFNGDECMLPPPDTYPFLPNSANANPITSLTMAASVLLAVMSIW

xxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
COBRA-like protein 4		confident	Q9LFW3
COBRA-like protein 5	Involved in determining the orientation of cell expansion, probably by playing an important role in cellulose deposition. May act by recruiting cellulose synthesizing complexes to discrete positions on the cell surface.	confident	Q10JL1
COBRA-like protein 5	Involved in determining the orientation of cell expansion, probably by playing an important role in cellulose deposition. May act by recruiting cellulose synthesizing complexes to discrete positions on the cell surface.	probable	A2XHZ9

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1EXG, chain A
Confidence level:probable
Coverage over the Query: 42-104
View the alignment between query and template
View the model in PyMOL