Citrus Sinensis ID: 013091

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------45

MSSAPWYLNSEKPSLKHQRKWKSDPNYTKSWYDRGAKVFHAEKYRKGACANCGAMTHDAKSCMERPRKMGAKWTNINIAPDEKIETFELDYDGKRDRWNGYDTSSYARVVERYEARDDARRKFNKEQQLKKLEEKNNNNDSGGGGDSDGEDEDDDLRIDEAKVDESKQMDFAKVEKRVRTTGGGSTGTVRNLRIREDTAKYLLNLDVNSAHYDPKTRSMREDPLPDADPNDKFYGGDNQYRNSGQALEFKELNIHAWEAFDKGQDIHMQAAPSQAELLYKNYIVIKDKLKSRTKETIMEKYGNAAAEEELPRELLLGQSEREIEYDRAGRIIKGQETALPRSKYEEDVYINNHTCVWGSWWKDHQWGYKCCKQVIRNSYCTGAAGIEAAEAASDLMKANIARKEASEETQTPVEGKRLATWGTDLPDDLVLDEDLLAEALKKVSMSSNL

ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHcccHHHHHHHHHcccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccEEccccHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHcccccEEEEcccccccccccccccccccccccccccccEEEEccccccccCCccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHcccccccccccccccccHHHHHHHHHHHHccccc

MSSAPWYLNSEKPSL***********YTKSWYDRGAKVFHAEKYRKGACANCGAMTHDAKSCMERPRKMGAKWTNINIAPDEKIETFELDYDGKRDRWNGYDTSSYARVVERY***************************************************************************VRNLRIREDTAKYLLNLDVNSAHYD************************NQYRNSGQALEFKELNIHAWEAFDKGQDIHMQAAPSQAELLYKNYIVIKDKLK*********************************EYDRAGRIIKGQETALPRSKYEEDVYINNHTCVWGSWWKDHQWGYKCCKQVIRNSYCTGAAGIEAA*******************************WGTDLPDDLVLDEDLL*************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MSSAPWYLNSEKPSLKHQRKWKSDPNYTKSWYDRGAKVFHAEKYRKGACANCGAMTHDAKSCMERPRKMGAKWTNINIAPDEKIETFELDYDGKRDRWNGYDTSSYARVVERYExxxxxxxxxxxxxxxxxxxxxNNNNDSGGGGDSDGEDEDDDLRIDEAKVDESKQMDFAKVEKRVRTTGGGSTGTVRNLRIREDTAKYLLNLDVNSAHYDPKTRSMREDPLPDADPNDKFYGGDNQYRNSGQALEFKELNIHAWEAFDKGQDIHMQAAPSQAELLYKNYIVIKDKLKSRTKETIMEKYGNAAAEEELPRELLLGQSEREIEYDRAGRIIKGQETALPRSKYEEDVYINNHTCVWGSWWKDHQWGYKCCKQVIRNSYCTGAAGIExxxxxxxxxxxxxxxxxxxxxTQTPVEGKRLATWGTDLPDDLVLDEDLLAEALKKVSMSSNL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Pre-mRNA-splicing factor SLU7-A	Participates in the second catalytic step of pre-mRNA splicing, when the free hydroxyl group of exon I attacks the 3'-splice site to generate spliced mRNA and the excised lariat intron.	confident	Q9SHY8
Pre-mRNA-splicing factor SLU7	Participates in the second catalytic step of pre-mRNA splicing, when the free hydroxyl group of exon I attacks the 3'-splice site to generate spliced mRNA and the excised lariat intron.	confident	Q6ZK48
Pre-mRNA-splicing factor SLU7	Participates in the second catalytic step of pre-mRNA splicing, when the free hydroxyl group of exon I attacks the 3'-splice site to generate spliced mRNA and the excised lariat intron.	probable	A2YQU8

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1U6P, chain A
Confidence level:probable
Coverage over the Query: 46-71
View the alignment between query and template
View the model in PyMOL