BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 013095
         (449 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3MN8|A Chain A, Structure Of Drosophila Melanogaster Carboxypeptidase D
           Isoform 1b Short
 pdb|3MN8|B Chain B, Structure Of Drosophila Melanogaster Carboxypeptidase D
           Isoform 1b Short
 pdb|3MN8|C Chain C, Structure Of Drosophila Melanogaster Carboxypeptidase D
           Isoform 1b Short
 pdb|3MN8|D Chain D, Structure Of Drosophila Melanogaster Carboxypeptidase D
           Isoform 1b Short
          Length = 435

 Score = 32.0 bits (71), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 20/35 (57%)

Query: 87  IPVVNDNKKCIRLDYKLAVTATGLRSLFDFLYIFY 121
           + V NDN++ +RLD+KLA   T    +  F   +Y
Sbjct: 400 VRVTNDNQEALRLDFKLAPVETNFDGISSFYSPYY 434


>pdb|3UKN|A Chain A, Structure Of The C-LinkerCNBHD OF ZELK CHANNELS IN C 2 2
           21 SPACE Group
 pdb|3UKN|B Chain B, Structure Of The C-LinkerCNBHD OF ZELK CHANNELS IN C 2 2
           21 SPACE Group
 pdb|3UKN|C Chain C, Structure Of The C-LinkerCNBHD OF ZELK CHANNELS IN C 2 2
           21 SPACE Group
 pdb|3UKT|B Chain B, Structure Of The C-LinkerCNBHD OF ZELK CHANNELS IN P1 21 1
           SPACE Group
 pdb|3UKT|A Chain A, Structure Of The C-LinkerCNBHD OF ZELK CHANNELS IN P1 21 1
           SPACE Group
 pdb|3UKT|C Chain C, Structure Of The C-LinkerCNBHD OF ZELK CHANNELS IN P1 21 1
           SPACE Group
 pdb|3UKT|D Chain D, Structure Of The C-LinkerCNBHD OF ZELK CHANNELS IN P1 21 1
           SPACE Group
 pdb|3UKV|B Chain B, Structure Of The C-LinkerCNBHD OF ZELK CHANNELS IN P 1 21
           1 SPACE Group, Crystallized In The Presence Of Camp
 pdb|3UKV|A Chain A, Structure Of The C-LinkerCNBHD OF ZELK CHANNELS IN P 1 21
           1 SPACE Group, Crystallized In The Presence Of Camp
 pdb|3UKV|C Chain C, Structure Of The C-LinkerCNBHD OF ZELK CHANNELS IN P 1 21
           1 SPACE Group, Crystallized In The Presence Of Camp
 pdb|3UKV|D Chain D, Structure Of The C-LinkerCNBHD OF ZELK CHANNELS IN P 1 21
           1 SPACE Group, Crystallized In The Presence Of Camp
          Length = 212

 Score = 28.9 bits (63), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 33/63 (52%)

Query: 380 RMQEMNEHMPIQKLSRSVQQQLKIYQRYIWRKPDTIDVESSLSILPKELRRNIKRELCLD 439
           R +++ + + + +L +++ Q++    +  W   + IDV   L   P ELR +I   L  +
Sbjct: 17  RTKDLKDFIRVHRLPKALAQRMLECFQTTWSVNNGIDVSELLKDFPDELRADIAMHLNKE 76

Query: 440 LLK 442
           LL+
Sbjct: 77  LLQ 79


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.326    0.140    0.430 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 12,070,758
Number of Sequences: 62578
Number of extensions: 465312
Number of successful extensions: 1020
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1018
Number of HSP's gapped (non-prelim): 2
length of query: 449
length of database: 14,973,337
effective HSP length: 102
effective length of query: 347
effective length of database: 8,590,381
effective search space: 2980862207
effective search space used: 2980862207
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 53 (25.0 bits)