BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 013095
(449 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3MN8|A Chain A, Structure Of Drosophila Melanogaster Carboxypeptidase D
Isoform 1b Short
pdb|3MN8|B Chain B, Structure Of Drosophila Melanogaster Carboxypeptidase D
Isoform 1b Short
pdb|3MN8|C Chain C, Structure Of Drosophila Melanogaster Carboxypeptidase D
Isoform 1b Short
pdb|3MN8|D Chain D, Structure Of Drosophila Melanogaster Carboxypeptidase D
Isoform 1b Short
Length = 435
Score = 32.0 bits (71), Expect = 0.71, Method: Compositional matrix adjust.
Identities = 13/35 (37%), Positives = 20/35 (57%)
Query: 87 IPVVNDNKKCIRLDYKLAVTATGLRSLFDFLYIFY 121
+ V NDN++ +RLD+KLA T + F +Y
Sbjct: 400 VRVTNDNQEALRLDFKLAPVETNFDGISSFYSPYY 434
>pdb|3UKN|A Chain A, Structure Of The C-LinkerCNBHD OF ZELK CHANNELS IN C 2 2
21 SPACE Group
pdb|3UKN|B Chain B, Structure Of The C-LinkerCNBHD OF ZELK CHANNELS IN C 2 2
21 SPACE Group
pdb|3UKN|C Chain C, Structure Of The C-LinkerCNBHD OF ZELK CHANNELS IN C 2 2
21 SPACE Group
pdb|3UKT|B Chain B, Structure Of The C-LinkerCNBHD OF ZELK CHANNELS IN P1 21 1
SPACE Group
pdb|3UKT|A Chain A, Structure Of The C-LinkerCNBHD OF ZELK CHANNELS IN P1 21 1
SPACE Group
pdb|3UKT|C Chain C, Structure Of The C-LinkerCNBHD OF ZELK CHANNELS IN P1 21 1
SPACE Group
pdb|3UKT|D Chain D, Structure Of The C-LinkerCNBHD OF ZELK CHANNELS IN P1 21 1
SPACE Group
pdb|3UKV|B Chain B, Structure Of The C-LinkerCNBHD OF ZELK CHANNELS IN P 1 21
1 SPACE Group, Crystallized In The Presence Of Camp
pdb|3UKV|A Chain A, Structure Of The C-LinkerCNBHD OF ZELK CHANNELS IN P 1 21
1 SPACE Group, Crystallized In The Presence Of Camp
pdb|3UKV|C Chain C, Structure Of The C-LinkerCNBHD OF ZELK CHANNELS IN P 1 21
1 SPACE Group, Crystallized In The Presence Of Camp
pdb|3UKV|D Chain D, Structure Of The C-LinkerCNBHD OF ZELK CHANNELS IN P 1 21
1 SPACE Group, Crystallized In The Presence Of Camp
Length = 212
Score = 28.9 bits (63), Expect = 5.4, Method: Compositional matrix adjust.
Identities = 16/63 (25%), Positives = 33/63 (52%)
Query: 380 RMQEMNEHMPIQKLSRSVQQQLKIYQRYIWRKPDTIDVESSLSILPKELRRNIKRELCLD 439
R +++ + + + +L +++ Q++ + W + IDV L P ELR +I L +
Sbjct: 17 RTKDLKDFIRVHRLPKALAQRMLECFQTTWSVNNGIDVSELLKDFPDELRADIAMHLNKE 76
Query: 440 LLK 442
LL+
Sbjct: 77 LLQ 79
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.326 0.140 0.430
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 12,070,758
Number of Sequences: 62578
Number of extensions: 465312
Number of successful extensions: 1020
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1018
Number of HSP's gapped (non-prelim): 2
length of query: 449
length of database: 14,973,337
effective HSP length: 102
effective length of query: 347
effective length of database: 8,590,381
effective search space: 2980862207
effective search space used: 2980862207
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 53 (25.0 bits)