BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 013102
         (449 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2YOO|A Chain A, Cholest-4-en-3-one Bound Structure Of Cyp142 From
           Mycobacterium Smegmatis
 pdb|2YOO|B Chain B, Cholest-4-en-3-one Bound Structure Of Cyp142 From
           Mycobacterium Smegmatis
 pdb|2YOO|C Chain C, Cholest-4-en-3-one Bound Structure Of Cyp142 From
           Mycobacterium Smegmatis
 pdb|2YOO|D Chain D, Cholest-4-en-3-one Bound Structure Of Cyp142 From
           Mycobacterium Smegmatis
 pdb|3ZBY|A Chain A, Ligand-free Structure Of Cyp142 From Mycobacterium
           Smegmatis
 pdb|3ZBY|B Chain B, Ligand-free Structure Of Cyp142 From Mycobacterium
           Smegmatis
 pdb|3ZBY|C Chain C, Ligand-free Structure Of Cyp142 From Mycobacterium
           Smegmatis
 pdb|3ZBY|D Chain D, Ligand-free Structure Of Cyp142 From Mycobacterium
           Smegmatis
 pdb|3ZBY|E Chain E, Ligand-free Structure Of Cyp142 From Mycobacterium
           Smegmatis
 pdb|3ZBY|F Chain F, Ligand-free Structure Of Cyp142 From Mycobacterium
           Smegmatis
          Length = 407

 Score = 34.3 bits (77), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 32/60 (53%), Gaps = 1/60 (1%)

Query: 218 DLFPFRLGNMMSYDKQLANMCTLFTFQS-FRKLLLQEGEKLVLVWLDTPYNQAVYGLVDK 276
           DL P  +  M+ +   + NMC   T  + F    L+ GEK++L++    ++++V+G  D 
Sbjct: 264 DLLPGAIEEMLRWTSPVKNMCRTLTADTVFHGTELRAGEKIMLMFESANFDESVFGDPDN 323


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.328    0.139    0.420 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,998,604
Number of Sequences: 62578
Number of extensions: 384068
Number of successful extensions: 831
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 830
Number of HSP's gapped (non-prelim): 5
length of query: 449
length of database: 14,973,337
effective HSP length: 102
effective length of query: 347
effective length of database: 8,590,381
effective search space: 2980862207
effective search space used: 2980862207
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 53 (25.0 bits)