Citrus Sinensis ID: 013121

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------45
MGSLETPTTTETNGSATPAVTSNGGDHKPPVTANGAPLSSTDSRMVMAQESEATRKRRASMLPLEVGTRVMCRWRDGKYHPVKVIERRKMHFGGPNDYEYYVHYTEFNRRLDEWVKLEQLDLDSVETVVDEKVEDKVTSLKMTRHQKRKIDETHVEGHEELDAASLREHEEFTKVKNIATIELGRYEIETWYFSPFPPEYNDCLKLYFCEFCLNFMKRKEQLQRHMRKCDLKHPPGDEIYRSGTLSMFEVDGKKNKVYGQNLCYLAKLFLDHKTLYYDVDLFLFYVLCECDDRGCHMVGYFSKEKHSEESYNLACILTLPPYQRKGYGKFLIAFSYELSKKEGKVGTPERPLSDLGLLSYRGYWTRVLLDILKKHKGNISIKELSDMTAIKAEDILTTLQSLELIQYRKGQHVICADPKVLDRHLKAAGRGGLEVDVSKLIWTPYKEQG
cccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccEEEEEEccccEEccEEEEEEcccccccccEEEEEEcccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccHHHHcccccccccccccccccccEEEEEcccccccccccccccEEEEccHHcccccHHHHHHHHcccccccccccEEEEcccEEEEEEcccccccHHHHHHHHHHHHccccccccccccEEEEEEEEEcccccEEEEEEccccccccccEEEEEEcccccccccccEEEEEEccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccEEEEHHcccccccccHHHHHHHcccEEEEccEEEEEEcHHHHHHHHHHHcccccEEEccccEEEcccccc
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccEEEEEcccccEccEEEEEEEEccccccccEEEEEEEEccccccHccccHHHccccccccccccccccccccccccccccccccccccccccccccHHHcccccEEccccccEEEEccEEEccccccccccccccccEEEEccccccEEccHHHHHHHHccccccccccEEEEEcccEEEEEEEHHHcHHHHHHHHHHHHccccccccccccccEEEEEEEEEEccEEEEEEEEEEEccccccEEEccEEEcHHHccccHHHHHHHHHHHHHHHccccEEEcccccHHHHHHHHHHHHHHHHHHHHHcccEEEHHHHHHHHcEcHHHHHHHHHHHccEEEEccEEEEEccHHHHHHHHHHHHcccccccHHHEccccccccc
mgsletptttetngsatpavtsnggdhkppvtangaplsstdsRMVMAQESEATRKRRasmlplevgtrvmcrwrdgkyhpvkVIERrkmhfggpndyeYYVHYTEFNRRLDEWVKLEQLDLDSVETVVDEKVEDKVTSLKMTRHQKRKIDETHVEGHEELDAASLREHEEFTKVKNIATIELGRYEietwyfspfppeyndclkLYFCEFCLNFMKRKEQLQRHMRkcdlkhppgdeiyrsgtlsmfevdgkknkvygQNLCYLAKLFLDhktlyydvDLFLFYVLCecddrgchmvgyfskekhseesynlaciltlppyqrkgygKFLIAFSYELSkkegkvgtperplsdlgllsyrGYWTRVLLDILKKHkgnisikelsdMTAIKAEDILTTLQSLELIQYRkgqhvicadpKVLDRHLKAagrgglevdVSKLIWTPYKEQG
mgsletptttetngsatpavtsnggdhkppvtangaplsstdsRMVMAQESeatrkrrasmlplevgtrvmcrwrdgkyhpvkvierrkmhfggpnDYEYYVHYTEFNRRLDEWVKLEQLdldsvetvvdekvedkvtslkmtrhqkrkidethvegheeldaaslreheeftkvkniatielGRYEIETWYFSPFPPEYNDCLKLYFCEFCLNFMKRKEQLQRHmrkcdlkhppgdeiyrsGTLSMFEVDGKKNKVYGQNLCYLAKLFLDHKTLYYDVDLFLFYVLCECDDRGCHMVGYFSKEKHSEESYNLACILTLPPYQRKGYGKFLIAFSYELSkkegkvgtperplsdlgllsyRGYWTRVLLDILKKHKGNISIKELSDMTAIKAEDILTTLQSLELIQYRKGQHVICADPKVLDRHLKAagrgglevdvskliwtpykeqg
MGSLETPTTTETNGSATPAVTSNGGDHKPPVTANGAPLSSTDSRMVMAQESEATRKRRASMLPLEVGTRVMCRWRDGKYHPVKVIERRKMHFGGPNDYEYYVHYTEFNRRLDEWVKLEQLDLdsvetvvdekvedkvtsLKMTRHQKRKIDETHVEGHEELDAASLREHEEFTKVKNIATIELGRYEIETWYFSPFPPEYNDCLKLYFCEFCLNFMKRKEQLQRHMRKCDLKHPPGDEIYRSGTLSMFEVDGKKNKVYGQNLCYLAKLFLDHKTLYYDVDLFLFYVLCECDDRGCHMVGYFSKEKHSEESYNLACILTLPPYQRKGYGKFLIAFSYELSKKEGKVGTPERPLSDLGLLSYRGYWTRVLLDILKKHKGNISIKELSDMTAIKAEDILTTLQSLELIQYRKGQHVICADPKVLDRHLKAAGRGGLEVDVSKLIWTPYKEQG
*************************************************************LPLEVGTRVMCRWRDGKYHPVKVIERRKMHFGGPNDYEYYVHYTEFNRRLDEWVKLEQLDLDSVETVVD****************************************EFTKVKNIATIELGRYEIETWYFSPFPPEYNDCLKLYFCEFCLNFMKRKEQLQRHMRKCDL*****DEIYRSGTLSMFEVDGKKNKVYGQNLCYLAKLFLDHKTLYYDVDLFLFYVLCECDDRGCHMVGYFSKEKHSEESYNLACILTLPPYQRKGYGKFLIAFSYELSK**********PLSDLGLLSYRGYWTRVLLDILKKHKGNISIKELSDMTAIKAEDILTTLQSLELIQYRKGQHVICADPKVLDRHLKAAGRGGLEVDVSKLIWTPY****
*******************************************************************TRVMCRWRDGKYHP******************YYVHYTEFNRRLDEWVKLEQLDLDSVE*************LKMTRHQKRKIDETHV******************KVKNIATIELGRYEIETWYFSPFPPEYNDCLKLYFCEFCLNFMKRKEQLQRHMRKCDLKHPPGDEIYRSGTLSMFEVDGKKNKVYGQNLCYLAKLFLDHKTLYYDVDLFLFYVLCECDDRGCHMVGYFSKEKHSEESYNLACILTLPPYQRKGYGKFLIAFSYELSKKEGK*GTPERPLSDLGLLSYRGYWTRVLLDILKKHKGNISIKELSDMTAIKAEDILTTLQSLELIQYRKGQHVICADPKVLDRHLKAAGRGGLEVDVSKLIWTPYK***
**************SATPAVTSNGGDHKPPVTANGA*********************RASMLPLEVGTRVMCRWRDGKYHPVKVIERRKMHFGGPNDYEYYVHYTEFNRRLDEWVKLEQLDLDSVETVVDEKVEDKVTSLKMTRHQKRKIDETHVEGHEELDAASLREHEEFTKVKNIATIELGRYEIETWYFSPFPPEYNDCLKLYFCEFCLNFMKRKEQLQRHMRKCDLKHPPGDEIYRSGTLSMFEVDGKKNKVYGQNLCYLAKLFLDHKTLYYDVDLFLFYVLCECDDRGCHMVGYFSKEKHSEESYNLACILTLPPYQRKGYGKFLIAFSYELSK*********RPLSDLGLLSYRGYWTRVLLDILKKHKGNISIKELSDMTAIKAEDILTTLQSLELIQYRKGQHVICADPKVLDRHLKAAGRGGLEVDVSKLIWTPYKEQG
***********************************************************SMLPLEVGTRVMCRWRDGKYHPVKVIERRKMHFGGPNDYEYYVHYTEFNRRLDEWVKLEQLDLD**********************************************EEFTKVKNIATIELGRYEIETWYFSPFPPEYNDCLKLYFCEFCLNFMKRKEQLQRHMRKCDLKHPPGDEIYRSGTLSMFEVDGKKNKVYGQNLCYLAKLFLDHKTLYYDVDLFLFYVLCECDDRGCHMVGYFSKEKHSEESYNLACILTLPPYQRKGYGKFLIAFSYELSKKEGKVGTPERPLSDLGLLSYRGYWTRVLLDILKKHKGNISIKELSDMTAIKAEDILTTLQSLELIQYRKGQHVICADPKVLDRHLKAAGRGGLEVDVSKLIWTPY****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSLETPTTTETNGSATPAVTSNGGDHKPPVTANGAPLSSTDSRMVMAQESEATRKRRASMLPLEVGTRVMCRWRDGKYHPVKVIERRKMHFGGPNDYEYYVHYTEFNRRLDEWVKLEQLDLDSVETVVDEKVEDKVTSLKMTRHQKRKIDETHVEGHEELDAASLREHEEFTKVKNIATIELGRYEIETWYFSPFPPEYNDCLKLYFCEFCLNFMKRKEQLQRHMRKCDLKHPPGDEIYRSGTLSMFEVDGKKNKVYGQNLCYLAKLFLDHKTLYYDVDLFLFYVLCECDDRGCHMVGYFSKEKHSEESYNLACILTLPPYQRKGYGKFLIAFSYELSKKEGKVGTPERPLSDLGLLSYRGYWTRVLLDILKKHKGNISIKELSDMTAIKAEDILTTLQSLELIQYRKGQHVICADPKVLDRHLKAAGRGGLEVDVSKLIWTPYKEQG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query449 2.2.26 [Sep-21-2011]
Q9FLF7445 Probable MYST-like histon yes no 0.984 0.993 0.858 0.0
Q9LXD7445 MYST-like histone acetylt no no 0.982 0.991 0.849 0.0
Q8LI34450 Putative MYST-like histon yes no 0.864 0.862 0.935 0.0
Q9H7Z6458 Histone acetyltransferase yes no 0.935 0.917 0.496 1e-114
Q5XI06458 Histone acetyltransferase yes no 0.881 0.864 0.516 1e-113
Q9D1P2458 Histone acetyltransferase yes no 0.881 0.864 0.516 1e-113
O02193827 Males-absent on the first yes no 0.826 0.448 0.452 1e-99
Q960X4541 Histone acetyltransferase no no 0.628 0.521 0.556 9e-96
Q99MK2513 Histone acetyltransferase no no 0.625 0.547 0.583 3e-94
Q8CHK4513 Histone acetyltransferase no no 0.625 0.547 0.583 3e-94
>sp|Q9FLF7|MYST1_ARATH Probable MYST-like histone acetyltransferase 1 OS=Arabidopsis thaliana GN=HAG4 PE=2 SV=1 Back     alignment and function desciption
 Score =  800 bits (2066), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/452 (85%), Positives = 411/452 (90%), Gaps = 10/452 (2%)

Query: 1   MGS---LETPTTTETNGSATPAVTSNGGDHKPPVTANGAPLSSTDSRMVMAQESEATRKR 57
           MGS    ET     T  S      +NGGD     T+ GA L+ T+S      ES+A++KR
Sbjct: 1   MGSSADTETAMIIATPASNHNNPATNGGDANQNHTS-GAILALTNS------ESDASKKR 53

Query: 58  RASMLPLEVGTRVMCRWRDGKYHPVKVIERRKMHFGGPNDYEYYVHYTEFNRRLDEWVKL 117
           R  +LPLEVGTRVMC+WRDGKYHPVKVIERRK + GG NDYEYYVHYTEFNRRLDEW+KL
Sbjct: 54  RMGVLPLEVGTRVMCQWRDGKYHPVKVIERRKNYNGGHNDYEYYVHYTEFNRRLDEWIKL 113

Query: 118 EQLDLDSVETVVDEKVEDKVTSLKMTRHQKRKIDETHVEGHEELDAASLREHEEFTKVKN 177
           EQLDLDSVE  +DEKVEDKVTSLKMTRHQKRKIDETHVEGHEELDAASLREHEEFTKVKN
Sbjct: 114 EQLDLDSVECALDEKVEDKVTSLKMTRHQKRKIDETHVEGHEELDAASLREHEEFTKVKN 173

Query: 178 IATIELGRYEIETWYFSPFPPEYNDCLKLYFCEFCLNFMKRKEQLQRHMRKCDLKHPPGD 237
           IATIELG+YEIETWYFSPFPPEYNDC+KL+FCEFCL+FMKRKEQLQRHMRKCDLKHPPGD
Sbjct: 174 IATIELGKYEIETWYFSPFPPEYNDCVKLFFCEFCLSFMKRKEQLQRHMRKCDLKHPPGD 233

Query: 238 EIYRSGTLSMFEVDGKKNKVYGQNLCYLAKLFLDHKTLYYDVDLFLFYVLCECDDRGCHM 297
           EIYRS TLSMFEVDGKKNKVY QNLCYLAKLFLDHKTLYYDVDLFLFY+LCECDDRGCHM
Sbjct: 234 EIYRSSTLSMFEVDGKKNKVYAQNLCYLAKLFLDHKTLYYDVDLFLFYILCECDDRGCHM 293

Query: 298 VGYFSKEKHSEESYNLACILTLPPYQRKGYGKFLIAFSYELSKKEGKVGTPERPLSDLGL 357
           VGYFSKEKHSEE+YNLACILTLPPYQRKGYGKFLIAFSYELSKKEGKVGTPERPLSDLGL
Sbjct: 294 VGYFSKEKHSEEAYNLACILTLPPYQRKGYGKFLIAFSYELSKKEGKVGTPERPLSDLGL 353

Query: 358 LSYRGYWTRVLLDILKKHKGNISIKELSDMTAIKAEDILTTLQSLELIQYRKGQHVICAD 417
           +SYRGYWTR+LLDILKKHKGNISIKELSDMTAIKAEDIL+TLQSLELIQYRKGQHVICAD
Sbjct: 354 VSYRGYWTRILLDILKKHKGNISIKELSDMTAIKAEDILSTLQSLELIQYRKGQHVICAD 413

Query: 418 PKVLDRHLKAAGRGGLEVDVSKLIWTPYKEQG 449
           PKVLDRHLKAAGRGGL+VDVSK+IWTPYKEQ 
Sbjct: 414 PKVLDRHLKAAGRGGLDVDVSKMIWTPYKEQS 445
Histone acetyltransferase which may be involved in transcriptional activation.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 3EC: .EC: 1EC: .EC: 4EC: 8
>sp|Q9LXD7|MYST2_ARATH MYST-like histone acetyltransferase 2 OS=Arabidopsis thaliana GN=HAG5 PE=2 SV=1 Back     alignment and function description
>sp|Q8LI34|MYST1_ORYSJ Putative MYST-like histone acetyltransferase 1 OS=Oryza sativa subsp. japonica GN=Os07g0626600 PE=3 SV=1 Back     alignment and function description
>sp|Q9H7Z6|KAT8_HUMAN Histone acetyltransferase KAT8 OS=Homo sapiens GN=KAT8 PE=1 SV=2 Back     alignment and function description
>sp|Q5XI06|KAT8_RAT Histone acetyltransferase KAT8 OS=Rattus norvegicus GN=Kat8 PE=2 SV=1 Back     alignment and function description
>sp|Q9D1P2|KAT8_MOUSE Histone acetyltransferase KAT8 OS=Mus musculus GN=Kat8 PE=1 SV=1 Back     alignment and function description
>sp|O02193|MOF_DROME Males-absent on the first protein OS=Drosophila melanogaster GN=mof PE=1 SV=1 Back     alignment and function description
>sp|Q960X4|TIP60_DROME Histone acetyltransferase Tip60 OS=Drosophila melanogaster GN=Tip60 PE=1 SV=1 Back     alignment and function description
>sp|Q99MK2|KAT5_RAT Histone acetyltransferase KAT5 OS=Rattus norvegicus GN=Kat5 PE=1 SV=2 Back     alignment and function description
>sp|Q8CHK4|KAT5_MOUSE Histone acetyltransferase KAT5 OS=Mus musculus GN=Kat5 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query449
224084820448 histone acetyltransferase [Populus trich 0.986 0.988 0.892 0.0
225459443439 PREDICTED: probable MYST-like histone ac 0.977 1.0 0.895 0.0
224063156445 histone acetyltransferase [Populus trich 0.991 1.0 0.890 0.0
255545556445 myst histone acetyltransferase, putative 0.991 1.0 0.893 0.0
356517734434 PREDICTED: probable MYST-like histone ac 0.962 0.995 0.893 0.0
356508266434 PREDICTED: probable MYST-like histone ac 0.962 0.995 0.890 0.0
3551247433 181 [Daucus carota] 0.962 0.997 0.883 0.0
15237745445 histone acetyltransferase MYST1 [Arabido 0.984 0.993 0.858 0.0
449445116448 PREDICTED: probable MYST-like histone ac 0.982 0.984 0.857 0.0
297811071441 hypothetical protein ARALYDRAFT_487793 [ 0.964 0.981 0.851 0.0
>gi|224084820|ref|XP_002307411.1| histone acetyltransferase [Populus trichocarpa] gi|222856860|gb|EEE94407.1| histone acetyltransferase [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  828 bits (2138), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/454 (89%), Positives = 418/454 (92%), Gaps = 11/454 (2%)

Query: 1   MGSLETPTTTETNGSATPAVTSNG-----GDHKPPVTANGAPLSSTDSRMVMAQESEATR 55
           MGS++TP   E NGS T   T++      GD  P    NG P   T+  M +  ESE  +
Sbjct: 1   MGSIDTPKNPE-NGSTTLPPTTDASATYDGDQNP---TNGMPPRVTE--MTLPVESEVVK 54

Query: 56  KRRASMLPLEVGTRVMCRWRDGKYHPVKVIERRKMHFGGPNDYEYYVHYTEFNRRLDEWV 115
           KR+ SMLPLEVGTRV+CRWRD KYHPVKVIERRKM  GG NDYEYYVHYTEFNRRLDEWV
Sbjct: 55  KRKTSMLPLEVGTRVLCRWRDCKYHPVKVIERRKMQSGGTNDYEYYVHYTEFNRRLDEWV 114

Query: 116 KLEQLDLDSVETVVDEKVEDKVTSLKMTRHQKRKIDETHVEGHEELDAASLREHEEFTKV 175
           KLEQLDLDSVETVVDEKVEDKVTSLKMTRHQKRKIDETHVEGHEELDAASLREHEEFTKV
Sbjct: 115 KLEQLDLDSVETVVDEKVEDKVTSLKMTRHQKRKIDETHVEGHEELDAASLREHEEFTKV 174

Query: 176 KNIATIELGRYEIETWYFSPFPPEYNDCLKLYFCEFCLNFMKRKEQLQRHMRKCDLKHPP 235
           KNIATIELGRYEIETWYFSPFPPEYNDCL+LYFCEFCLNFMKRKEQLQRHM+KCDLKHPP
Sbjct: 175 KNIATIELGRYEIETWYFSPFPPEYNDCLQLYFCEFCLNFMKRKEQLQRHMKKCDLKHPP 234

Query: 236 GDEIYRSGTLSMFEVDGKKNKVYGQNLCYLAKLFLDHKTLYYDVDLFLFYVLCECDDRGC 295
           GDEIYRSGTLSMFE+DGKKNKVYGQNLCYLAKLFLDHKTLYYDVDLFLFYVLCECDDRGC
Sbjct: 235 GDEIYRSGTLSMFEIDGKKNKVYGQNLCYLAKLFLDHKTLYYDVDLFLFYVLCECDDRGC 294

Query: 296 HMVGYFSKEKHSEESYNLACILTLPPYQRKGYGKFLIAFSYELSKKEGKVGTPERPLSDL 355
           HMVGYFSKEKHSEESYNLACILTLPPYQRKGYGKFLIAFSYELSKKEGKVGTPERPLSDL
Sbjct: 295 HMVGYFSKEKHSEESYNLACILTLPPYQRKGYGKFLIAFSYELSKKEGKVGTPERPLSDL 354

Query: 356 GLLSYRGYWTRVLLDILKKHKGNISIKELSDMTAIKAEDILTTLQSLELIQYRKGQHVIC 415
           GLLSYRGYWTRVLLDILK+HKGNISIKELSDMTAIKAEDILTTLQSLELIQYRKGQHVIC
Sbjct: 355 GLLSYRGYWTRVLLDILKRHKGNISIKELSDMTAIKAEDILTTLQSLELIQYRKGQHVIC 414

Query: 416 ADPKVLDRHLKAAGRGGLEVDVSKLIWTPYKEQG 449
           ADPKVLDRHLKAAGRGGLEVDVSKLIWTPYKEQG
Sbjct: 415 ADPKVLDRHLKAAGRGGLEVDVSKLIWTPYKEQG 448

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225459443|ref|XP_002285829.1| PREDICTED: probable MYST-like histone acetyltransferase 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224063156|ref|XP_002301018.1| histone acetyltransferase [Populus trichocarpa] gi|222842744|gb|EEE80291.1| histone acetyltransferase [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255545556|ref|XP_002513838.1| myst histone acetyltransferase, putative [Ricinus communis] gi|223546924|gb|EEF48421.1| myst histone acetyltransferase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356517734|ref|XP_003527541.1| PREDICTED: probable MYST-like histone acetyltransferase 1-like [Glycine max] Back     alignment and taxonomy information
>gi|356508266|ref|XP_003522879.1| PREDICTED: probable MYST-like histone acetyltransferase 1-like [Glycine max] Back     alignment and taxonomy information
>gi|3551247|dbj|BAA32822.1| 181 [Daucus carota] Back     alignment and taxonomy information
>gi|15237745|ref|NP_201266.1| histone acetyltransferase MYST1 [Arabidopsis thaliana] gi|75262659|sp|Q9FLF7.1|MYST1_ARATH RecName: Full=Probable MYST-like histone acetyltransferase 1 gi|10178064|dbj|BAB11428.1| histone acetyltransferase [Arabidopsis thaliana] gi|20466436|gb|AAM20535.1| histone acetyltransferase [Arabidopsis thaliana] gi|23198138|gb|AAN15596.1| histone acetyltransferase [Arabidopsis thaliana] gi|225879160|dbj|BAH30650.1| hypothetical protein [Arabidopsis thaliana] gi|332010543|gb|AED97926.1| histone acetyltransferase MYST1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449445116|ref|XP_004140319.1| PREDICTED: probable MYST-like histone acetyltransferase 1-like [Cucumis sativus] gi|449527145|ref|XP_004170573.1| PREDICTED: probable MYST-like histone acetyltransferase 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297811071|ref|XP_002873419.1| hypothetical protein ARALYDRAFT_487793 [Arabidopsis lyrata subsp. lyrata] gi|297319256|gb|EFH49678.1| hypothetical protein ARALYDRAFT_487793 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query449
TAIR|locus:2174764445 HAM1 "AT5G64610" [Arabidopsis 0.962 0.970 0.835 2.7e-203
TAIR|locus:2144776445 HAM2 "AT5G09740" [Arabidopsis 0.975 0.984 0.821 7.1e-203
DICTYBASE|DDB_G0279699657 DDB_G0279699 "HAM group protei 0.674 0.461 0.654 3.1e-125
DICTYBASE|DDB_G0275017639 DDB_G0275017 "HAM group protei 0.619 0.435 0.690 5.1e-121
ZFIN|ZDB-GENE-030131-7510502 kat8 "K(lysine) acetyltransfer 0.971 0.868 0.469 6.5e-106
UNIPROTKB|F1MP98458 KAT8 "Uncharacterized protein" 0.955 0.936 0.485 1.1e-105
UNIPROTKB|Q9H7Z6458 KAT8 "Histone acetyltransferas 0.955 0.936 0.485 1.4e-105
UNIPROTKB|F1RIR8458 MYST1 "Uncharacterized protein 0.955 0.936 0.485 1.4e-105
MGI|MGI:1915023458 Kat8 "K(lysine) acetyltransfer 0.955 0.936 0.484 1.7e-105
UNIPROTKB|E2QT63458 MYST1 "Uncharacterized protein 0.951 0.932 0.485 2.2e-105
TAIR|locus:2174764 HAM1 "AT5G64610" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1967 (697.5 bits), Expect = 2.7e-203, P = 2.7e-203
 Identities = 372/445 (83%), Positives = 396/445 (88%)

Query:     4 LETPTTTETNGSATPAVTSNGGDHKPPVTANGAPLSSTDSRMVMAQESEATRKRRASMLP 63
             + TP +   N    PA  +NGGD     T+ GA L+ T+S      ES+A++KRR  +LP
Sbjct:    13 IATPASNHNN----PA--TNGGDANQNHTS-GAILALTNS------ESDASKKRRMGVLP 59

Query:    64 LEVGTRVMCRWRDGKYHPVKVIERRKMHFGGPNDYEYYVHYTEFNRRLDEWVKLEQLDLX 123
             LEVGTRVMC+WRDGKYHPVKVIERRK + GG NDYEYYVHYTEFNRRLDEW+KLEQLDL 
Sbjct:    60 LEVGTRVMCQWRDGKYHPVKVIERRKNYNGGHNDYEYYVHYTEFNRRLDEWIKLEQLDLD 119

Query:   124 XXXXXXXXXXXXXXXXLKMTRHQKRKIDETHVEGHEELDAASLREHEEFTKVKNIATIEL 183
                             LKMTRHQKRKIDETHVEGHEELDAASLREHEEFTKVKNIATIEL
Sbjct:   120 SVECALDEKVEDKVTSLKMTRHQKRKIDETHVEGHEELDAASLREHEEFTKVKNIATIEL 179

Query:   184 GRYEIETWYFSPFPPEYNDCLKLYFCEFCLNFMKRKEQLQRHMRKCDLKHPPGDEIYRSG 243
             G+YEIETWYFSPFPPEYNDC+KL+FCEFCL+FMKRKEQLQRHMRKCDLKHPPGDEIYRS 
Sbjct:   180 GKYEIETWYFSPFPPEYNDCVKLFFCEFCLSFMKRKEQLQRHMRKCDLKHPPGDEIYRSS 239

Query:   244 TLSMFEVDGKKNKVYGQNLCYLAKLFLDHKTLYYDVDLFLFYVLCECDDRGCHMVGYFSK 303
             TLSMFEVDGKKNKVY QNLCYLAKLFLDHKTLYYDVDLFLFY+LCECDDRGCHMVGYFSK
Sbjct:   240 TLSMFEVDGKKNKVYAQNLCYLAKLFLDHKTLYYDVDLFLFYILCECDDRGCHMVGYFSK 299

Query:   304 EKHSEESYNLACILTLPPYQRKGYGKFLIAFSYELSKKEGKVGTPERPLSDLGLLSYRGY 363
             EKHSEE+YNLACILTLPPYQRKGYGKFLIAFSYELSKKEGKVGTPERPLSDLGL+SYRGY
Sbjct:   300 EKHSEEAYNLACILTLPPYQRKGYGKFLIAFSYELSKKEGKVGTPERPLSDLGLVSYRGY 359

Query:   364 WTRVLLDILKKHKGNISIKELSDMTAIKAEDILTTLQSLELIQYRKGQHVICADPKVLDR 423
             WTR+LLDILKKHKGNISIKELSDMTAIKAEDIL+TLQSLELIQYRKGQHVICADPKVLDR
Sbjct:   360 WTRILLDILKKHKGNISIKELSDMTAIKAEDILSTLQSLELIQYRKGQHVICADPKVLDR 419

Query:   424 HLKAAGRGGLEVDVSKLIWTPYKEQ 448
             HLKAAGRGGL+VDVSK+IWTPYKEQ
Sbjct:   420 HLKAAGRGGLDVDVSKMIWTPYKEQ 444
GO:0003676 "nucleic acid binding" evidence=ISS
GO:0005634 "nucleus" evidence=ISM;IEA;IDA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0008270 "zinc ion binding" evidence=ISS
GO:0016747 "transferase activity, transferring acyl groups other than amino-acyl groups" evidence=IEA
GO:0004402 "histone acetyltransferase activity" evidence=ISS;IDA
GO:0006281 "DNA repair" evidence=IMP
GO:0010224 "response to UV-B" evidence=IEP
GO:0008284 "positive regulation of cell proliferation" evidence=RCA
TAIR|locus:2144776 HAM2 "AT5G09740" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0279699 DDB_G0279699 "HAM group protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0275017 DDB_G0275017 "HAM group protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-7510 kat8 "K(lysine) acetyltransferase 8" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1MP98 KAT8 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H7Z6 KAT8 "Histone acetyltransferase KAT8" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RIR8 MYST1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1915023 Kat8 "K(lysine) acetyltransferase 8" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2QT63 MYST1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9FLF7MYST1_ARATH2, ., 3, ., 1, ., 4, 80.85840.98440.9932yesno
Q8LI34MYST1_ORYSJ2, ., 3, ., 1, ., 4, 80.93580.86410.8622yesno
Q9LXD7MYST2_ARATH2, ., 3, ., 1, ., 4, 80.84980.98210.9910nono
Q6C710ESA1_YARLI2, ., 3, ., 1, ., 4, 80.38460.89530.8571yesno
Q5XI06KAT8_RAT2, ., 3, ., 1, ., 4, 80.51690.88190.8646yesno
Q9D1P2KAT8_MOUSE2, ., 3, ., 1, ., 4, 80.51690.88190.8646yesno
Q9H7Z6KAT8_HUMAN2, ., 3, ., 1, ., 4, 80.49650.93540.9170yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.3.10.998
3rd Layer2.3.1.480.994

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
HAG901
histone acetyltransferase (EC-2.3.1.48) (448 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query449
PLN00104450 PLN00104, PLN00104, MYST -like histone acetyltrans 0.0
PLN03238290 PLN03238, PLN03238, probable histone acetyltransfe 1e-152
PLN03239351 PLN03239, PLN03239, histone acetyltransferase; Pro 1e-130
COG5027395 COG5027, SAS2, Histone acetyltransferase (MYST fam 1e-128
pfam01853189 pfam01853, MOZ_SAS, MOZ/SAS family 1e-122
PTZ00064552 PTZ00064, PTZ00064, histone acetyltransferase; Pro 1e-112
pfam1171755 pfam11717, Tudor-knot, RNA binding activity-knot o 1e-18
smart0029855 smart00298, CHROMO, Chromatin organization modifie 3e-06
cd0002455 cd00024, CHROMO, Chromatin organization modifier ( 4e-06
cd0430165 cd04301, NAT_SF, N-Acyltransferase superfamily: Va 0.004
>gnl|CDD|215056 PLN00104, PLN00104, MYST -like histone acetyltransferase; Provisional Back     alignment and domain information 
 Score =  846 bits (2188), Expect = 0.0
 Identities = 376/453 (83%), Positives = 393/453 (86%), Gaps = 14/453 (3%)

Query: 3   SLETPTTTETNGSATPAVTSNGGDHKPPVTANGAPLSSTDSRMVMAQESEATRKRRASML 62
           S+E P T +    A PA             A      +  +      ES+ ++KR   ML
Sbjct: 1   SMEAPATEDAGRPAAPA--------ASDDAAATDGAGANAAAPAAPAESDPSKKRPGVML 52

Query: 63  PLEVGTRVMCRWR-DGKYHPVKVIERRKMHFGGPNDYEYYVHYTEFNRRLDEWVKLEQLD 121
           PLEVGTRVMCRWR DGKYHPVKVIERR+   GGPNDYEYYVHYTEFNRRLDEWVKLEQLD
Sbjct: 53  PLEVGTRVMCRWRFDGKYHPVKVIERRRGGSGGPNDYEYYVHYTEFNRRLDEWVKLEQLD 112

Query: 122 LDSVETVVDEKVEDKVTSLKMTRHQKRKIDETHVE-GHEELDAASLREHEEFTKVKNIAT 180
           LD+VETV DEKVEDKV SLKMTRHQKRKIDETHVE GHEELDAASLREHEEFTKVKNIAT
Sbjct: 113 LDTVETVGDEKVEDKVASLKMTRHQKRKIDETHVEEGHEELDAASLREHEEFTKVKNIAT 172

Query: 181 IELGRYEIETWYFSPFPPEYNDCLKLYFCEFCLNFMKRKEQLQRHMRKCDLKHPPGDEIY 240
           IELGRYEI+TWYFSPFPPEYNDC KLYFCEFCL FMKRKEQLQRHM+KCDLKHPPGDEIY
Sbjct: 173 IELGRYEIDTWYFSPFPPEYNDCSKLYFCEFCLKFMKRKEQLQRHMKKCDLKHPPGDEIY 232

Query: 241 RSGT----LSMFEVDGKKNKVYGQNLCYLAKLFLDHKTLYYDVDLFLFYVLCECDDRGCH 296
           R  T    LSMFEVDGKKNKVY QNLCYLAKLFLDHKTLYYDVDLFLFYVLCECDDRGCH
Sbjct: 233 RHPTRQEGLSMFEVDGKKNKVYCQNLCYLAKLFLDHKTLYYDVDLFLFYVLCECDDRGCH 292

Query: 297 MVGYFSKEKHSEESYNLACILTLPPYQRKGYGKFLIAFSYELSKKEGKVGTPERPLSDLG 356
           MVGYFSKEKHSEE YNLACILTLPPYQRKGYGKFLIAFSYELSK+EGKVGTPERPLSDLG
Sbjct: 293 MVGYFSKEKHSEEDYNLACILTLPPYQRKGYGKFLIAFSYELSKREGKVGTPERPLSDLG 352

Query: 357 LLSYRGYWTRVLLDILKKHKGNISIKELSDMTAIKAEDILTTLQSLELIQYRKGQHVICA 416
           L+SYRGYWTRVLL+ILKKHKGNISIKELSDMTAIKAEDI++TLQSL LIQYRKGQHVICA
Sbjct: 353 LVSYRGYWTRVLLEILKKHKGNISIKELSDMTAIKAEDIVSTLQSLNLIQYRKGQHVICA 412

Query: 417 DPKVLDRHLKAAGRGGLEVDVSKLIWTPYKEQG 449
           DPKVL+ HLKAAGRGGLEVD SKLIWTPYKEQ 
Sbjct: 413 DPKVLEEHLKAAGRGGLEVDPSKLIWTPYKEQP 445

Length = 450
>gnl|CDD|215642 PLN03238, PLN03238, probable histone acetyltransferase MYST; Provisional Back     alignment and domain information
>gnl|CDD|178777 PLN03239, PLN03239, histone acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|227360 COG5027, SAS2, Histone acetyltransferase (MYST family) [Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|216741 pfam01853, MOZ_SAS, MOZ/SAS family Back     alignment and domain information
>gnl|CDD|173359 PTZ00064, PTZ00064, histone acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|152153 pfam11717, Tudor-knot, RNA binding activity-knot of a chromodomain Back     alignment and domain information
>gnl|CDD|214605 smart00298, CHROMO, Chromatin organization modifier domain Back     alignment and domain information
>gnl|CDD|237991 cd00024, CHROMO, Chromatin organization modifier (chromo) domain is a conserved region of around 50 amino acids found in a variety of chromosomal proteins, which appear to play a role in the functional organization of the eukaryotic nucleus Back     alignment and domain information
>gnl|CDD|173926 cd04301, NAT_SF, N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 449
PLN00104450 MYST -like histone acetyltransferase; Provisional 100.0
PTZ00064552 histone acetyltransferase; Provisional 100.0
PLN03239351 histone acetyltransferase; Provisional 100.0
KOG2747396 consensus Histone acetyltransferase (MYST family) 100.0
PLN03238290 probable histone acetyltransferase MYST; Provision 100.0
COG5027395 SAS2 Histone acetyltransferase (MYST family) [Chro 100.0
PF01853188 MOZ_SAS: MOZ/SAS family; InterPro: IPR002717 Moz i 100.0
PF1171755 Tudor-knot: RNA binding activity-knot of a chromod 99.73
smart0033357 TUDOR Tudor domain. Domain of unknown function pre 97.16
PF13673117 Acetyltransf_10: Acetyltransferase (GNAT) domain; 96.0
smart0029855 CHROMO Chromatin organization modifier domain. 95.9
cd0450848 TUDOR Tudor domains are found in many eukaryotic o 95.87
cd0002455 CHROMO Chromatin organization modifier (chromo) do 95.78
PF0058383 Acetyltransf_1: Acetyltransferase (GNAT) family; I 95.6
PRK10146144 aminoalkylphosphonic acid N-acetyltransferase; Pro 95.48
PRK07757152 acetyltransferase; Provisional 95.33
PF0085586 PWWP: PWWP domain; InterPro: IPR000313 Upon charac 95.19
smart0056196 MBT Present in Drosophila Scm, l(3)mbt, and verteb 95.1
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 94.95
PF1350879 Acetyltransf_7: Acetyltransferase (GNAT) domain; P 94.87
PF0933952 HTH_IclR: IclR helix-turn-helix domain; InterPro: 94.69
PRK10514145 putative acetyltransferase; Provisional 94.46
PRK09831147 putative acyltransferase; Provisional 94.34
TIGR02382191 wecD_rffC TDP-D-fucosamine acetyltransferase. This 94.33
smart0074361 Agenet Tudor-like domain present in plant sequence 94.17
PHA01807153 hypothetical protein 94.16
PF0564168 Agenet: Agenet domain; InterPro: IPR008395 This do 94.16
PRK10975194 TDP-fucosamine acetyltransferase; Provisional 94.12
PF06003264 SMN: Survival motor neuron protein (SMN); InterPro 94.11
TIGR01575131 rimI ribosomal-protein-alanine acetyltransferase. 93.86
PRK12308614 bifunctional argininosuccinate lyase/N-acetylgluta 93.85
cd0430165 NAT_SF N-Acyltransferase superfamily: Various enzy 93.68
KOG3216163 consensus Diamine acetyltransferase [Amino acid tr 93.65
smart0055068 Zalpha Z-DNA-binding domain in adenosine deaminase 93.31
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 93.21
smart0029363 PWWP domain with conserved PWWP motif. conservatio 93.19
PLN02825515 amino-acid N-acetyltransferase 93.06
KOG3001391 consensus Dosage compensation regulatory complex/h 93.05
TIGR03827266 GNAT_ablB putative beta-lysine N-acetyltransferase 92.95
PLN02706150 glucosamine 6-phosphate N-acetyltransferase 92.92
PF13527127 Acetyltransf_9: Acetyltransferase (GNAT) domain; P 92.86
PRK10140162 putative acetyltransferase YhhY; Provisional 92.75
PRK03624140 putative acetyltransferase; Provisional 92.46
PRK07922169 N-acetylglutamate synthase; Validated 92.43
PRK13688156 hypothetical protein; Provisional 92.23
PRK05279441 N-acetylglutamate synthase; Validated 91.84
PRK10562145 putative acetyltransferase; Provisional 91.83
cd0516287 PWWP The PWWP domain, named for a conserved Pro-Tr 91.71
PF0946555 LBR_tudor: Lamin-B receptor of TUDOR domain; Inter 91.61
cd0583483 HDGF_related The PWWP domain is an essential part 91.48
COG0454156 WecD Histone acetyltransferase HPA2 and related ac 91.4
PF0844586 FR47: FR47-like protein; InterPro: IPR013653 Prote 91.35
TIGR02431 248 pcaR_pcaU beta-ketoadipate pathway transcriptional 91.18
PF1232477 HTH_15: Helix-turn-helix domain of alkylmercury ly 90.79
TIGR03448292 mycothiol_MshD mycothiol biosynthesis acetyltransf 90.79
PF13420155 Acetyltransf_4: Acetyltransferase (GNAT) domain; P 90.68
smart0034691 HTH_ICLR helix_turn_helix isocitrate lyase regulat 90.55
TIGR01890429 N-Ac-Glu-synth amino-acid N-acetyltransferase. Thi 90.38
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 90.35
PF0822057 HTH_DeoR: DeoR-like helix-turn-helix domain; Inter 90.08
PTZ00330147 acetyltransferase; Provisional 90.05
PF0197868 TrmB: Sugar-specific transcriptional regulator Trm 89.97
smart0041948 HTH_CRP helix_turn_helix, cAMP Regulatory protein. 89.94
TIGR00124 332 cit_ly_ligase [citrate (pro-3S)-lyase] ligase. ATP 89.79
COG0456177 RimI Acetyltransferases [General function predicti 89.65
PRK10314153 putative acyltransferase; Provisional 89.31
cd0009267 HTH_CRP helix_turn_helix, cAMP Regulatory protein 89.09
smart0041866 HTH_ARSR helix_turn_helix, Arsenical Resistance Op 88.94
TIGR03103 547 trio_acet_GNAT GNAT-family acetyltransferase TIGR0 88.33
PF1341248 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 87.88
PF1354576 HTH_Crp_2: Crp-like helix-turn-helix domain; PDB: 87.81
TIGR02406157 ectoine_EctA L-2,4-diaminobutyric acid acetyltrans 87.72
PRK10163 271 DNA-binding transcriptional repressor AllR; Provis 87.63
TIGR03448292 mycothiol_MshD mycothiol biosynthesis acetyltransf 87.58
KOG2696403 consensus Histone acetyltransferase type b catalyt 87.56
cd0583587 Dnmt3b_related The PWWP domain is an essential com 87.29
PF0476054 IF2_N: Translation initiation factor IF-2, N-termi 87.18
PF0827955 HTH_11: HTH domain; InterPro: IPR013196 Winged hel 86.62
cd0009078 HTH_ARSR Arsenical Resistance Operon Repressor and 86.55
PF0172665 LexA_DNA_bind: LexA DNA binding domain; InterPro: 86.22
PF13302142 Acetyltransf_3: Acetyltransferase (GNAT) domain; P 86.15
PF0208283 Rrf2: Transcriptional regulator; InterPro: IPR0009 86.11
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 85.96
PF1346368 HTH_27: Winged helix DNA-binding domain; PDB: 3GFL 85.87
PHA0276855 hypothetical protein; Provisional 85.5
cd02169 297 Citrate_lyase_ligase Citrate lyase ligase. Citrate 85.42
PF0102247 HTH_5: Bacterial regulatory protein, arsR family; 85.23
PF1280262 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP 85.12
PF0738190 DUF1495: Winged helix DNA-binding domain (DUF1495) 83.7
PRK11569 274 transcriptional repressor IclR; Provisional 83.4
PF08784102 RPA_C: Replication protein A C terminal; InterPro: 83.27
PRK09834 263 DNA-binding transcriptional activator MhpR; Provis 83.12
cd05837110 MSH6_like The PWWP domain is present in MSH6, a mi 82.85
cd0584093 SPBC215_ISWI_like The PWWP domain is a component o 82.69
smart0042053 HTH_DEOR helix_turn_helix, Deoxyribose operon repr 82.48
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 82.36
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 82.36
PF0231971 E2F_TDP: E2F/DP family winged-helix DNA-binding do 81.81
PRK15090 257 DNA-binding transcriptional regulator KdgR; Provis 81.26
PRK09491146 rimI ribosomal-protein-alanine N-acetyltransferase 81.14
smart0035526 ZnF_C2H2 zinc finger. 80.95
cd0583686 N_Pac_NP60 The PWWP domain is an essential part of 80.91
PRK06266178 transcription initiation factor E subunit alpha; V 80.83
PF0990490 HTH_43: Winged helix-turn helix; InterPro: IPR0171 80.83
COG1414 246 IclR Transcriptional regulator [Transcription] 80.61
PRK13239206 alkylmercury lyase; Provisional 80.47
>PLN00104 MYST -like histone acetyltransferase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=2.1e-147  Score=1135.51  Aligned_cols=400  Identities=92%  Similarity=1.478  Sum_probs=369.6

Q ss_pred             hhHHHHHhhcCCCCcccCcEEEEEec-CCceeeEEEEEEeccCCCCCCceeEEEecccccccccccccccccccCCcccc
Q 013121           50 ESEATRKRRASMLPLEVGTRVMCRWR-DGKYHPVKVIERRKMHFGGPNDYEYYVHYTEFNRRLDEWVKLEQLDLDSVETV  128 (449)
Q Consensus        50 e~~~~~~~~~~~~~~~vGerVl~~~~-dg~~~~AeVIe~R~~~~~~~~~~~YYVHY~g~nkRlDEWV~~~rl~l~~~~~~  128 (449)
                      +.++.......+..|+||++|+|+|. +|++|+|+||++|..+.+..+.++|||||.||||||||||+.+||+++..+..
T Consensus        40 ~~~~~~~~~~~~~~~~VGekVla~~~~Dg~~~~A~VI~~R~~~~~~~~~~~YYVHY~g~nrRlDEWV~~~rLdls~~e~~  119 (450)
T PLN00104         40 ESDPSKKRPGVMLPLEVGTRVMCRWRFDGKYHPVKVIERRRGGSGGPNDYEYYVHYTEFNRRLDEWVKLEQLDLDTVETV  119 (450)
T ss_pred             CCCccccCCCccceeccCCEEEEEECCCCCEEEEEEEEEeccCCCCCCCceEEEEEecCCccHhhccCHhhccccccccc
Confidence            44445556778889999999999997 79999999999997442224567999999999999999999999999876654


Q ss_pred             ccccccccccccccccccccccccccc-CCCccCChhhhhhhhcccccCCccEEEecceeeecccCCCCCcCcCCCCcEE
Q 013121          129 VDEKVEDKVTSLKMTRHQKRKIDETHV-EGHEELDAASLREHEEFTKVKNIATIELGRYEIETWYFSPFPPEYNDCLKLY  207 (449)
Q Consensus       129 ~~~~~~~~~~~~~~~r~~kr~~~~~~~-~~~~~~d~~~~~~~~~~t~~rni~~I~~G~y~i~tWY~SPYP~e~~~~~~ly  207 (449)
                      ...+..+.....+.||++||+.++.+. +.++++++..+++|+++|++|||++|+||+|+|+||||||||+||.++++||
T Consensus       120 ~~~~~~~~~~~~k~TR~qKRK~eEin~ve~~~~~d~~~l~~~ee~tk~kni~~i~~G~y~i~~WY~SPyP~e~~~~~~ly  199 (450)
T PLN00104        120 GDEKVEDKVASLKMTRHQKRKIDETHVEEGHEELDAASLREHEEFTKVKNIATIELGRYEIDTWYFSPFPPEYNDCSKLY  199 (450)
T ss_pred             ccccccCcccccccchhhccccccccccccccccCcccccccccccccCccCEEEECCeEeeeeecCCCChHHcCCCeEE
Confidence            433332222455788999999887643 4567888888999999999999999999999999999999999999999999


Q ss_pred             EeccccccccCHHHHHHHHhhCCCCCCCccEEEecCC----eEEEEEeCccCcchhhhhhHHhhhhcccccceecCCCce
Q 013121          208 FCEFCLNFMKRKEQLQRHMRKCDLKHPPGDEIYRSGT----LSMFEVDGKKNKVYGQNLCYLAKLFLDHKTLYYDVDLFL  283 (449)
Q Consensus       208 iCe~Cl~y~~~~~~l~~H~~~C~~~~PPG~eIYr~~~----isifEVDG~~~k~yCQnLCLlaKLFLdhKTlyyDV~~Fl  283 (449)
                      ||||||+||+++.+|.+|+.+|.++||||+||||+++    ||||||||+++++|||||||||||||||||||||||+|+
T Consensus       200 iCe~Cl~y~~~~~~~~~H~~~C~~~~PPG~eIYr~~~~~~~~si~EvDG~~~~~yCqnLcLlaKLFLdhKtlyydV~~Fl  279 (450)
T PLN00104        200 FCEFCLKFMKRKEQLQRHMKKCDLKHPPGDEIYRHPTRQEGLSMFEVDGKKNKVYCQNLCYLAKLFLDHKTLYYDVDLFL  279 (450)
T ss_pred             EchhhhhhhcCHHHHHHHHhcCCCCCCCcCeEEEcCCCCceEEEEEEeCCcchhHHHHHHHHHHHhhcCcceeccccceE
Confidence            9999999999999999999999999999999999998    999999999999999999999999999999999999999


Q ss_pred             EEEEEEecCCCceeeeeecccccCCCCceeeEEeecCcccccccchhhhhhchhhhhccCCCCCCCccCChhhhhHHHhh
Q 013121          284 FYVLCECDDRGCHMVGYFSKEKHSEESYNLACILTLPPYQRKGYGKFLIAFSYELSKKEGKVGTPERPLSDLGLLSYRGY  363 (449)
Q Consensus       284 FYVl~e~d~~g~h~vGYFSKEK~s~~~~NLaCIl~lP~yQrkGyG~~LI~fSYeLSr~E~~~G~PErPLSDLG~~sY~sY  363 (449)
                      ||||||.|+.|+||||||||||.|+++||||||||||||||||||+|||+|||+|||+||++|||||||||||+++|++|
T Consensus       280 FYvl~e~d~~g~h~vGyFSKEk~s~~~~NLaCIltlP~yQrkGyG~~LI~~SYeLSr~eg~~G~PEkPLSdlG~~sY~~Y  359 (450)
T PLN00104        280 FYVLCECDDRGCHMVGYFSKEKHSEEDYNLACILTLPPYQRKGYGKFLIAFSYELSKREGKVGTPERPLSDLGLVSYRGY  359 (450)
T ss_pred             EEEEEEecCCCcEEEEEecccccCcCCCceEEEEecchhhhcchhheehhheehhhhccCCCCCCCCCCCHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hHHHHHHHHHhCCCCccHHHHHHhcCCChHHHHHHHHhcCceeeeCCeEEEEeCHHHHHHHHHHhcCCCceeeCCCceEe
Q 013121          364 WTRVLLDILKKHKGNISIKELSDMTAIKAEDILTTLQSLELIQYRKGQHVICADPKVLDRHLKAAGRGGLEVDVSKLIWT  443 (449)
Q Consensus       364 W~~~il~~L~~~~~~isi~~is~~Tgi~~~DIi~tL~~l~ll~~~~g~~~i~~~~~~i~~~~~~~~~~~~~id~~~L~W~  443 (449)
                      |+++|+++|.++.+.+||++||++|||+.+|||+||++||||+|++|+|+|++++++|++++++..++++.|||++|+|+
T Consensus       360 W~~~i~~~L~~~~~~~si~~is~~T~i~~~Dii~tL~~l~~l~~~kg~~~i~~~~~~i~~~~~~~~~~~~~i~~~~L~W~  439 (450)
T PLN00104        360 WTRVLLEILKKHKGNISIKELSDMTAIKAEDIVSTLQSLNLIQYRKGQHVICADPKVLEEHLKAAGRGGLEVDPSKLIWT  439 (450)
T ss_pred             HHHHHHHHHHhcCCCccHHHHHHHhCCCHHHHHHHHHHCCCEEecCCcEEEEECHHHHHHHHHHhcCCCcEEchhhcEEe
Confidence            99999999999888999999999999999999999999999999999999999999999999998899999999999999


Q ss_pred             cCCCCC
Q 013121          444 PYKEQG  449 (449)
Q Consensus       444 P~~~~~  449 (449)
                      |+...+
T Consensus       440 p~~~~~  445 (450)
T PLN00104        440 PYKEQP  445 (450)
T ss_pred             CCCCCC
Confidence            987653

>PTZ00064 histone acetyltransferase; Provisional Back     alignment and domain information
>PLN03239 histone acetyltransferase; Provisional Back     alignment and domain information
>KOG2747 consensus Histone acetyltransferase (MYST family) [Chromatin structure and dynamics] Back     alignment and domain information
>PLN03238 probable histone acetyltransferase MYST; Provisional Back     alignment and domain information
>COG5027 SAS2 Histone acetyltransferase (MYST family) [Chromatin structure and dynamics] Back     alignment and domain information
>PF01853 MOZ_SAS: MOZ/SAS family; InterPro: IPR002717 Moz is a monocytic leukemia Zn_finger protein and the SAS protein from Saccharomyces cerevisiae (Baker's yeast) is involved in silencing the Hmr locus Back     alignment and domain information
>PF11717 Tudor-knot: RNA binding activity-knot of a chromodomain ; PDB: 2EKO_A 2RO0_A 2RNZ_A 1WGS_A 3E9G_A 3E9F_A 2K3X_A 2K3Y_A 2EFI_A 2F5K_F Back     alignment and domain information
>smart00333 TUDOR Tudor domain Back     alignment and domain information
>PF13673 Acetyltransf_10: Acetyltransferase (GNAT) domain; PDB: 2FIW_A 1BOB_A 3FNC_B 3EXN_A Back     alignment and domain information
>smart00298 CHROMO Chromatin organization modifier domain Back     alignment and domain information
>cd04508 TUDOR Tudor domains are found in many eukaryotic organisms and have been implicated in protein-protein interactions in which methylated protein substrates bind to these domains Back     alignment and domain information
>cd00024 CHROMO Chromatin organization modifier (chromo) domain is a conserved region of around 50 amino acids found in a variety of chromosomal proteins, which appear to play a role in the functional organization of the eukaryotic nucleus Back     alignment and domain information
>PF00583 Acetyltransf_1: Acetyltransferase (GNAT) family; InterPro: IPR000182 The N-acetyltransferases (NAT) (EC 2 Back     alignment and domain information
>PRK10146 aminoalkylphosphonic acid N-acetyltransferase; Provisional Back     alignment and domain information
>PRK07757 acetyltransferase; Provisional Back     alignment and domain information
>PF00855 PWWP: PWWP domain; InterPro: IPR000313 Upon characterisation of WHSC1, a gene mapping to the Wolf-Hirschhornsyndrome critical region and at its C terminus similar to the Drosophila melanogaster ASH1/trithorax group proteins, a novel protein domain designated PWWP domain was identified [] Back     alignment and domain information
>smart00561 MBT Present in Drosophila Scm, l(3)mbt, and vertebrate SCML2 Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13508 Acetyltransf_7: Acetyltransferase (GNAT) domain; PDB: 3EY5_A 3FRM_B 3D8P_B 3GY9_A 3GYA_A 3S6F_A 2Q7B_A 1CM0_B 1XEB_B 1Y7R_A Back     alignment and domain information
>PF09339 HTH_IclR: IclR helix-turn-helix domain; InterPro: IPR005471 The many bacterial transcription regulation proteins which bind DNA through a 'helix-turn-helix' motif can be classified into subfamilies on the basis of sequence similarities Back     alignment and domain information
>PRK10514 putative acetyltransferase; Provisional Back     alignment and domain information
>PRK09831 putative acyltransferase; Provisional Back     alignment and domain information
>TIGR02382 wecD_rffC TDP-D-fucosamine acetyltransferase Back     alignment and domain information
>smart00743 Agenet Tudor-like domain present in plant sequences Back     alignment and domain information
>PHA01807 hypothetical protein Back     alignment and domain information
>PF05641 Agenet: Agenet domain; InterPro: IPR008395 This domain is related to the TUDOR domain IPR008191 from INTERPRO [] Back     alignment and domain information
>PRK10975 TDP-fucosamine acetyltransferase; Provisional Back     alignment and domain information
>PF06003 SMN: Survival motor neuron protein (SMN); InterPro: IPR010304 This family consists of several eukaryotic survival motor neuron (SMN) proteins Back     alignment and domain information
>TIGR01575 rimI ribosomal-protein-alanine acetyltransferase Back     alignment and domain information
>PRK12308 bifunctional argininosuccinate lyase/N-acetylglutamate synthase; Provisional Back     alignment and domain information
>cd04301 NAT_SF N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate Back     alignment and domain information
>KOG3216 consensus Diamine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>smart00550 Zalpha Z-DNA-binding domain in adenosine deaminases Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>smart00293 PWWP domain with conserved PWWP motif Back     alignment and domain information
>PLN02825 amino-acid N-acetyltransferase Back     alignment and domain information
>KOG3001 consensus Dosage compensation regulatory complex/histone acetyltransferase complex, subunit MSL-3/MRG15/EAF3, and related CHROMO domain-containing proteins [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>TIGR03827 GNAT_ablB putative beta-lysine N-acetyltransferase Back     alignment and domain information
>PLN02706 glucosamine 6-phosphate N-acetyltransferase Back     alignment and domain information
>PF13527 Acetyltransf_9: Acetyltransferase (GNAT) domain; PDB: 3SXN_C 2I00_D 1M4D_B 1M44_A 1M4G_B 1M4I_A 2OZG_A 2HV2_F 3N7Z_A 3RYO_B Back     alignment and domain information
>PRK10140 putative acetyltransferase YhhY; Provisional Back     alignment and domain information
>PRK03624 putative acetyltransferase; Provisional Back     alignment and domain information
>PRK07922 N-acetylglutamate synthase; Validated Back     alignment and domain information
>PRK13688 hypothetical protein; Provisional Back     alignment and domain information
>PRK05279 N-acetylglutamate synthase; Validated Back     alignment and domain information
>PRK10562 putative acetyltransferase; Provisional Back     alignment and domain information
>cd05162 PWWP The PWWP domain, named for a conserved Pro-Trp-Trp-Pro motif, is a small domain consisting of 100-150 amino acids Back     alignment and domain information
>PF09465 LBR_tudor: Lamin-B receptor of TUDOR domain; InterPro: IPR019023 The Lamin-B receptor is a chromatin and lamin binding protein in the inner nuclear membrane Back     alignment and domain information
>cd05834 HDGF_related The PWWP domain is an essential part of the Hepatoma Derived Growth Factor (HDGF) family of proteins, and is necessary for DNA binding by HDGF Back     alignment and domain information
>COG0454 WecD Histone acetyltransferase HPA2 and related acetyltransferases [Transcription / General function prediction only] Back     alignment and domain information
>PF08445 FR47: FR47-like protein; InterPro: IPR013653 Proteins in this entry have a conserved region similar to the C-terminal region of the Drosophila melanogaster (Fruit fly) hypothetical protein FR47 (Q9VR51 from SWISSPROT) Back     alignment and domain information
>TIGR02431 pcaR_pcaU beta-ketoadipate pathway transcriptional regulators, PcaR/PcaU/PobR family Back     alignment and domain information
>PF12324 HTH_15: Helix-turn-helix domain of alkylmercury lyase; InterPro: IPR024259 Alkylmercury lyase (EC:4 Back     alignment and domain information
>TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase Back     alignment and domain information
>PF13420 Acetyltransf_4: Acetyltransferase (GNAT) domain; PDB: 3DR8_A 3DR6_A 2AE6_B 2JLM_C 2J8R_A 1YVO_B 2J8M_A 2J8N_A 2BL1_A 3IWG_A Back     alignment and domain information
>smart00346 HTH_ICLR helix_turn_helix isocitrate lyase regulation Back     alignment and domain information
>TIGR01890 N-Ac-Glu-synth amino-acid N-acetyltransferase Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF08220 HTH_DeoR: DeoR-like helix-turn-helix domain; InterPro: IPR001034 The deoR-type HTH domain is a DNA-binding, helix-turn-helix (HTH) domain of about 50-60 amino acids present in transcription regulators of the deoR family, involved in sugar catabolism Back     alignment and domain information
>PTZ00330 acetyltransferase; Provisional Back     alignment and domain information
>PF01978 TrmB: Sugar-specific transcriptional regulator TrmB; InterPro: IPR002831 TrmB, is a protein of 38,800 apparent molecular weight, that is involved in the maltose-specific regulation of the trehalose/maltose ABC transport operon in Thermococcus litoralis Back     alignment and domain information
>smart00419 HTH_CRP helix_turn_helix, cAMP Regulatory protein Back     alignment and domain information
>TIGR00124 cit_ly_ligase [citrate (pro-3S)-lyase] ligase Back     alignment and domain information
>COG0456 RimI Acetyltransferases [General function prediction only] Back     alignment and domain information
>PRK10314 putative acyltransferase; Provisional Back     alignment and domain information
>cd00092 HTH_CRP helix_turn_helix, cAMP Regulatory protein C-terminus; DNA binding domain of prokaryotic regulatory proteins belonging to the catabolite activator protein family Back     alignment and domain information
>smart00418 HTH_ARSR helix_turn_helix, Arsenical Resistance Operon Repressor Back     alignment and domain information
>TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 Back     alignment and domain information
>PF13412 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 1I1G_B 2IA0_B 3I4P_A 2GQQ_A 2L4A_A 2CFX_B 2DBB_B 2EFO_A 2EFQ_A 2PN6_A Back     alignment and domain information
>PF13545 HTH_Crp_2: Crp-like helix-turn-helix domain; PDB: 3LA2_A 3LA3_B 3LA7_A 3B02_A 3E97_A 2H6C_B 1OMI_A 2BGC_H 2BEO_A 2GAU_A Back     alignment and domain information
>TIGR02406 ectoine_EctA L-2,4-diaminobutyric acid acetyltransferase Back     alignment and domain information
>PRK10163 DNA-binding transcriptional repressor AllR; Provisional Back     alignment and domain information
>TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase Back     alignment and domain information
>KOG2696 consensus Histone acetyltransferase type b catalytic subunit [Chromatin structure and dynamics] Back     alignment and domain information
>cd05835 Dnmt3b_related The PWWP domain is an essential component of DNA methyltransferase 3 B (Dnmt3b) which is responsible for establishing DNA methylation patterns during embryogenesis and gametogenesis Back     alignment and domain information
>PF04760 IF2_N: Translation initiation factor IF-2, N-terminal region; InterPro: IPR006847 This region is found in the N-terminal half of translation initiation factor IF-2 Back     alignment and domain information
>PF08279 HTH_11: HTH domain; InterPro: IPR013196 Winged helix DNA-binding proteins share a related winged helix-turn-helix DNA-binding motif, where the "wings", or loops, are small beta-sheets Back     alignment and domain information
>cd00090 HTH_ARSR Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors Back     alignment and domain information
>PF01726 LexA_DNA_bind: LexA DNA binding domain; InterPro: IPR006199 This is the DNA binding domain of the LexA SOS regulon repressor which prevents expression of DNA repair proteins in bacteria Back     alignment and domain information
>PF13302 Acetyltransf_3: Acetyltransferase (GNAT) domain; PDB: 3TTH_C 3JUW_A 2ZXV_A 2Z0Z_A 2VI7_B 3EG7_F 1YRE_C 3IGR_B 3FBU_A 2FCK_A Back     alignment and domain information
>PF02082 Rrf2: Transcriptional regulator; InterPro: IPR000944 The following uncharacterised bacterial proteins have been shown to be evolutionary related, Desulfovibrio vulgaris protein Rrf2; Escherichia coli hypothetical proteins yfhP and yjeB; Bacillus subtilis hypothetical proteins yhdE, yrzC and ywgB; Mycobacterium tuberculosis hypothetical protein Rv1287; and Synechocystis sp Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF13463 HTH_27: Winged helix DNA-binding domain; PDB: 3GFL_A 2YR2_B 3GFM_A 3GFJ_A 3GF2_A 3GEZ_A 2GXG_A 3GFI_A 2EB7_A Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>cd02169 Citrate_lyase_ligase Citrate lyase ligase Back     alignment and domain information
>PF01022 HTH_5: Bacterial regulatory protein, arsR family; InterPro: IPR001845 Bacterial transcription regulatory proteins that bind DNA via a helix-turn-helix (HTH) motif can be grouped into families on the basis of sequence similarities Back     alignment and domain information
>PF12802 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP4_B 3KP2_A 3KP5_A 3KP3_B 3KP7_A 3NQO_B 3K0L_B Back     alignment and domain information
>PF07381 DUF1495: Winged helix DNA-binding domain (DUF1495); InterPro: IPR010863 This family consists of several hypothetical archaeal proteins of around 110 residues in length Back     alignment and domain information
>PRK11569 transcriptional repressor IclR; Provisional Back     alignment and domain information
>PF08784 RPA_C: Replication protein A C terminal; InterPro: IPR014892 This protein corresponds to the C-terminal of the single stranded DNA binding protein RPA (replication protein A) Back     alignment and domain information
>PRK09834 DNA-binding transcriptional activator MhpR; Provisional Back     alignment and domain information
>cd05837 MSH6_like The PWWP domain is present in MSH6, a mismatch repair protein homologous to bacterial MutS Back     alignment and domain information
>cd05840 SPBC215_ISWI_like The PWWP domain is a component of the S Back     alignment and domain information
>smart00420 HTH_DEOR helix_turn_helix, Deoxyribose operon repressor Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>PF02319 E2F_TDP: E2F/DP family winged-helix DNA-binding domain; InterPro: IPR003316 The mammalian transcription factor E2F plays an important role in regulating the expression of genes that are required for passage through the cell cycle Back     alignment and domain information
>PRK15090 DNA-binding transcriptional regulator KdgR; Provisional Back     alignment and domain information
>PRK09491 rimI ribosomal-protein-alanine N-acetyltransferase; Provisional Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>cd05836 N_Pac_NP60 The PWWP domain is an essential part of the cytokine-like nuclear factor n-pac protein, or NP60, which enhances the activity of MAP2K4 and MAP2K6 kinases to phosphorylate p38-alpha Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>PF09904 HTH_43: Winged helix-turn helix; InterPro: IPR017162 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>COG1414 IclR Transcriptional regulator [Transcription] Back     alignment and domain information
>PRK13239 alkylmercury lyase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query449
4dnc_A289 Crystal Structure Of Human Mof In Complex With Msl1 1e-95
3qah_A304 Crystal Structure Of Apo-Form Human Mof Catalytic D 4e-94
2pq8_A278 Myst Histone Acetyltransferase 1 Length = 278 5e-93
2ou2_A280 Acetyltransferase Domain Of Human Hiv-1 Tat Interac 8e-93
2giv_A295 Human Myst Histone Acetyltransferase 1 Length = 295 1e-92
2y0m_A287 Crystal Structure Of The Complex Between Dosage Com 6e-92
3toa_A266 Human Mof Crystal Structure With Active Site Lysine 7e-90
3tob_A270 Human Mof E350q Crystal Structure With Active Site 8e-90
1fy7_A278 Crystal Structure Of Yeast Esa1 Histone Acetyltrans 1e-86
3to6_A276 Crystal Structure Of Yeast Esa1 Hat Domain Complexe 4e-86
1mj9_A278 Crystal Structure Of Yeast Esa1(C304s) Mutant Compl 7e-86
3to9_A276 Crystal Structure Of Yeast Esa1 E338q Hat Domain Bo 9e-86
1mja_A278 Crystal Structure Of Yeast Esa1 Histone Acetyltrans 1e-85
1mjb_A278 Crystal Structure Of Yeast Esa1 Histone Acetyltrans 3e-85
2ozu_A284 Crystal Structure Of Human Myst Histone Acetyltrans 3e-83
2rc4_A287 Crystal Structure Of The Hat Domain Of The Human Mo 9e-83
1wgs_A133 Solution Structure Of The Tudor Domain From Mouse H 2e-08
2eko_A87 Solution Structure Of Ruh-073, A Pseudo Chromo Doma 6e-04
>pdb|4DNC|A Chain A, Crystal Structure Of Human Mof In Complex With Msl1 Length = 289 Back     alignment and structure 
Iteration: 1

 Score =  347 bits (889), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 163/282 (57%), Positives = 211/282 (74%), Gaps = 2/282 (0%)
Query: 169 HEEFTKVKNIATIELGRYEIETWYFSPFPPEYNDCLKLYFCEFCLNFMKRKEQLQRHMRK 228
           HE  TKVK +  I +G YEI+ WYFSPFP +Y    KL+ CE+CL +MK ++  + H+ +
Sbjct: 1   HEAITKVKYVDKIHIGNYEIDAWYFSPFPEDYGKQPKLWLCEYCLKYMKYEKSYRFHLGQ 60
Query: 229 CDLKHPPGDEIYRSGTLSMFEVDGKKNKVYGQNLCYLAKLFLDHKTLYYDVDLFLFYVLC 288
           C  + PPG EIYR   +S++EVDGK +K+Y QNLC LAKLFLDH TLY+DV+ F+FY+L 
Sbjct: 61  CQWRQPPGKEIYRKSNISVYEVDGKDHKIYCQNLCLLAKLFLDHXTLYFDVEPFVFYILT 120
Query: 289 ECDDRGCHMVGYFSKEKHSEESYNLACILTLPPYQRKGYGKFLIAFSYELSKKEGKVGTP 348
           E D +G H+VGYFSKEK S +  N+ACILTLPPYQR+GYGKFLIAFSYELSK E  VG+P
Sbjct: 121 EVDRQGAHIVGYFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSP 180
Query: 349 ERPLSDLGLLSYRGYWTRVLLDILKKHKGNISIKELSDMTAIKAEDILTTLQSLELIQYR 408
           E+PLSDLG LSYR YW+ VLL+IL+  +G +SIK+LS MT+I   DI++TLQSL +++Y 
Sbjct: 181 EKPLSDLGKLSYRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQNDIISTLQSLNMVKYW 240
Query: 409 KGQHVICADPKVLDRHLKAA--GRGGLEVDVSKLIWTPYKEQ 448
           KGQHVIC  PK+++ HLK+A   +  + VD   L W P K +
Sbjct: 241 KGQHVICVTPKLVEEHLKSAQYKKPPITVDSVCLKWAPPKHK 282
>pdb|3QAH|A Chain A, Crystal Structure Of Apo-Form Human Mof Catalytic Domain Length = 304 Back     alignment and structure
>pdb|2PQ8|A Chain A, Myst Histone Acetyltransferase 1 Length = 278 Back     alignment and structure
>pdb|2OU2|A Chain A, Acetyltransferase Domain Of Human Hiv-1 Tat Interacting Protein, 60kda, Isoform 3 Length = 280 Back     alignment and structure
>pdb|2GIV|A Chain A, Human Myst Histone Acetyltransferase 1 Length = 295 Back     alignment and structure
>pdb|2Y0M|A Chain A, Crystal Structure Of The Complex Between Dosage Compensation Factors Msl1 And Mof Length = 287 Back     alignment and structure
>pdb|1FY7|A Chain A, Crystal Structure Of Yeast Esa1 Histone Acetyltransferase Domain Complexed With Coenzyme A Length = 278 Back     alignment and structure
>pdb|3TO6|A Chain A, Crystal Structure Of Yeast Esa1 Hat Domain Complexed With H4k16coa Bisubstrate Inhibitor Length = 276 Back     alignment and structure
>pdb|1MJ9|A Chain A, Crystal Structure Of Yeast Esa1(C304s) Mutant Complexed With Coenzyme A Length = 278 Back     alignment and structure
>pdb|3TO9|A Chain A, Crystal Structure Of Yeast Esa1 E338q Hat Domain Bound To Coenzyme A With Active Site Lysine Acetylated Length = 276 Back     alignment and structure
>pdb|1MJA|A Chain A, Crystal Structure Of Yeast Esa1 Histone Acetyltransferase Domain Complexed With Acetyl Coenzyme A Length = 278 Back     alignment and structure
>pdb|1MJB|A Chain A, Crystal Structure Of Yeast Esa1 Histone Acetyltransferase E338q Mutant Complexed With Acetyl Coenzyme A Length = 278 Back     alignment and structure
>pdb|2OZU|A Chain A, Crystal Structure Of Human Myst Histone Acetyltransferase 3 In Complex With Acetylcoenzyme A Length = 284 Back     alignment and structure
>pdb|2RC4|A Chain A, Crystal Structure Of The Hat Domain Of The Human Moz Protein Length = 287 Back     alignment and structure
>pdb|1WGS|A Chain A, Solution Structure Of The Tudor Domain From Mouse Hypothetical Protein Homologous To Histone Acetyltransferase Length = 133 Back     alignment and structure
>pdb|2EKO|A Chain A, Solution Structure Of Ruh-073, A Pseudo Chromo Domain From Human Cdna Length = 87 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query449
3to7_A276 Histone acetyltransferase ESA1; MYST family; HET: 1e-144
2pq8_A278 Probable histone acetyltransferase MYST1; MOF, str 1e-143
2ou2_A280 Histone acetyltransferase htatip; structural genom 1e-140
2ozu_A284 Histone acetyltransferase MYST3; structural genomi 1e-136
1wgs_A133 MYST histone acetyltransferase 1; tudor domain, MY 7e-28
2eko_A87 Histone acetyltransferase htatip; chromo domain, h 1e-18
2rnz_A94 Histone acetyltransferase ESA1; HAT, chromodomain, 7e-18
2bud_A92 Males-absent on the first protein; transferase, MO 1e-17
2ro0_A92 Histone acetyltransferase ESA1; HAT, chromodomain, 2e-17
1bob_A320 HAT1, histone acetyltransferase; histone modificat 8e-12
2lcc_A76 AT-rich interactive domain-containing protein 4A; 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-04
2eqm_A88 PHD finger protein 20-like 1; structural genomics, 2e-07
2p0w_A324 Histone acetyltransferase type B catalytic subuni; 8e-06
3sd4_A69 PHD finger protein 20; tudor domain, transcription 1e-05
2f5k_A102 MORF-related gene 15 isoform 1; beta barrel, gene 2e-05
>3to7_A Histone acetyltransferase ESA1; MYST family; HET: ALY COA; 1.90A {Saccharomyces cerevisiae} PDB: 3to6_A* 1fy7_A* 1mja_A* 1mjb_A* 3to9_A* 1mj9_A* Length = 276 Back     alignment and structure
 Score =  413 bits (1062), Expect = e-144
 Identities = 147/275 (53%), Positives = 199/275 (72%)

Query: 171 EFTKVKNIATIELGRYEIETWYFSPFPPEYNDCLKLYFCEFCLNFMKRKEQLQRHMRKCD 230
           E  +V+N+  I +G+YEIE WYFSP+P E  D   +Y  +F L +   K+Q +R+ +KC 
Sbjct: 1   EVARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCT 60

Query: 231 LKHPPGDEIYRSGTLSMFEVDGKKNKVYGQNLCYLAKLFLDHKTLYYDVDLFLFYVLCEC 290
           L+HPPG+EIYR   +S FE+DG+K + + +NLC L+KLFLDHKTLYYDVD FLFY +   
Sbjct: 61  LRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTRR 120

Query: 291 DDRGCHMVGYFSKEKHSEESYNLACILTLPPYQRKGYGKFLIAFSYELSKKEGKVGTPER 350
           D+ G H+VGYFSKEK S + YN+ACILTLP YQR GYGK LI FSYELSKKE KVG+PE+
Sbjct: 121 DELGHHLVGYFSKEKESADGYNVACILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPEK 180

Query: 351 PLSDLGLLSYRGYWTRVLLDILKKHKGNISIKELSDMTAIKAEDILTTLQSLELIQYRKG 410
           PLSDLGLLSYR YW+  L+ +L +H+  I+I E+S MT++   DIL T ++L +++Y KG
Sbjct: 181 PLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKG 240

Query: 411 QHVICADPKVLDRHLKAAGRGGLEVDVSKLIWTPY 445
           QH+I  +  +LDR+ +   +    +D ++LIW P 
Sbjct: 241 QHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPP 275
>2pq8_A Probable histone acetyltransferase MYST1; MOF, structural genomics, structural genomics consortium, SGC; HET: COA; 1.45A {Homo sapiens} PDB: 2giv_A* 3qah_A* 2y0m_A* 3toa_A* 3tob_A* Length = 278 Back     alignment and structure
>2ou2_A Histone acetyltransferase htatip; structural genomics, structural genomics consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} Length = 280 Back     alignment and structure
>2ozu_A Histone acetyltransferase MYST3; structural genomics, structural G consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} SCOP: d.108.1.1 PDB: 2rc4_A* 1m36_A Length = 284 Back     alignment and structure
>1wgs_A MYST histone acetyltransferase 1; tudor domain, MYST family, struct genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.34.13.3 Length = 133 Back     alignment and structure
>2eko_A Histone acetyltransferase htatip; chromo domain, histone tail, chromatin organization modifier, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>2rnz_A Histone acetyltransferase ESA1; HAT, chromodomain, tudor domain, RNA binding, activator, chromatin regulator, transcription; NMR {Saccharomyces cerevisiae} Length = 94 Back     alignment and structure
>2bud_A Males-absent on the first protein; transferase, MOF, HAT, acetyl-transfer, dosage compensation complex, DCC, royal family; NMR {Drosophila melanogaster} SCOP: b.34.13.3 Length = 92 Back     alignment and structure
>2ro0_A Histone acetyltransferase ESA1; HAT, chromodomain, tudor domain, RNA binding, activator, chromatin regulator, transcription; NMR {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
>1bob_A HAT1, histone acetyltransferase; histone modification, acetyl coenzyme A binding-protein; HET: ACO; 2.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 Length = 320 Back     alignment and structure
>2lcc_A AT-rich interactive domain-containing protein 4A; chromobarrel domain, RBBP1, transcription; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2eqm_A PHD finger protein 20-like 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2jtf_A Length = 88 Back     alignment and structure
>2p0w_A Histone acetyltransferase type B catalytic subuni; HAT1, structural genomics, structural genomics consortium, S transferase; HET: ACO; 1.90A {Homo sapiens} Length = 324 Back     alignment and structure
>3sd4_A PHD finger protein 20; tudor domain, transcription; 1.93A {Homo sapiens} PDB: 3q1j_A Length = 69 Back     alignment and structure
>2f5k_A MORF-related gene 15 isoform 1; beta barrel, gene regulation; 2.20A {Homo sapiens} SCOP: b.34.13.3 PDB: 2efi_A Length = 102 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query449
3to7_A276 Histone acetyltransferase ESA1; MYST family; HET: 100.0
2ou2_A280 Histone acetyltransferase htatip; structural genom 100.0
2pq8_A278 Probable histone acetyltransferase MYST1; MOF, str 100.0
2ozu_A284 Histone acetyltransferase MYST3; structural genomi 100.0
1wgs_A133 MYST histone acetyltransferase 1; tudor domain, MY 99.86
2p0w_A324 Histone acetyltransferase type B catalytic subuni; 99.79
2rnz_A94 Histone acetyltransferase ESA1; HAT, chromodomain, 99.76
2ro0_A92 Histone acetyltransferase ESA1; HAT, chromodomain, 99.76
2eko_A87 Histone acetyltransferase htatip; chromo domain, h 99.74
2lcc_A76 AT-rich interactive domain-containing protein 4A; 99.66
2bud_A92 Males-absent on the first protein; transferase, MO 99.65
2f5k_A102 MORF-related gene 15 isoform 1; beta barrel, gene 99.64
2lrq_A85 Protein MRG15, NUA4 complex subunit EAF3 homolog; 99.41
3oa6_A110 MALE-specific lethal 3 homolog; chromodomain, MSL3 99.55
3m9q_A101 Protein MALE-specific lethal-3; chromodomain, MSL3 99.53
3m9p_A110 MALE-specific lethal 3 homolog; chromodomain, MSL3 99.51
2k3y_A136 Chromatin modification-related protein EAF3; dimet 99.46
3e9g_A130 Chromatin modification-related protein EAF3; chrom 99.34
1bob_A320 HAT1, histone acetyltransferase; histone modificat 98.93
2eqm_A88 PHD finger protein 20-like 1; structural genomics, 98.65
3sd4_A69 PHD finger protein 20; tudor domain, transcription 98.52
3h8z_A128 FragIle X mental retardation syndrome-related Pro; 97.49
4hcz_A58 PHD finger protein 1; protein-peptide complex, tud 97.37
4a4f_A64 SurviVal of motor neuron-related-splicing factor; 97.15
2e5p_A68 Protein PHF1, PHD finger protein 1; tudor domain, 97.12
2eqj_A66 Metal-response element-binding transcription facto 96.99
2xk0_A69 Polycomb protein PCL; transcription, aromatic CAGE 96.97
1mhn_A59 SurviVal motor neuron protein; SMN, SMA, spinal mu 96.94
2e5q_A63 PHD finger protein 19; tudor domain, isoform B, st 96.74
2m0o_A79 PHD finger protein 1; tudor domain, H3K36ME3 bindi 96.69
2equ_A74 PHD finger protein 20-like 1; tudor domain, struct 96.68
3efa_A147 Putative acetyltransferase; structural genom 2, pr 96.55
3s6w_A54 Tudor domain-containing protein 3; methylated argi 96.44
3p8d_A67 Medulloblastoma antigen MU-MB-50.72; tudor domain, 96.38
2atr_A138 Acetyltransferase, GNAT family; MCSG, structural g 96.36
3gy9_A150 GCN5-related N-acetyltransferase; YP_001815201.1, 96.22
1y7r_A133 Hypothetical protein SA2161; structural genomics, 96.21
2d9t_A78 Tudor domain-containing protein 3; structural geno 96.11
1g5v_A88 SurviVal motor neuron protein 1; mRNA processing, 95.95
3e0k_A150 Amino-acid acetyltransferase; N-acetylglutamate sy 95.94
3qii_A85 PHD finger protein 20; tudor domain, structural ge 95.93
1r57_A102 Conserved hypothetical protein; GCN5, N-acetyltran 95.88
3t90_A149 Glucose-6-phosphate acetyltransferase 1; GNAT fold 95.83
3pp9_A187 Putative streptothricin acetyltransferase; toxin p 95.77
1yvk_A163 Hypothetical protein BSU33890; ALPHS-beta protein, 95.72
3lod_A162 Putative acyl-COA N-acyltransferase; structural ge 95.67
1tiq_A180 Protease synthase and sporulation negative regulat 95.66
2ozh_A142 Hypothetical protein XCC2953; structural genomics, 95.6
3owc_A188 Probable acetyltransferase; structural genomics, P 95.57
3mgd_A157 Predicted acetyltransferase; structural genomics, 95.53
2jdc_A146 Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1. 95.5
3ey5_A181 Acetyltransferase-like, GNAT family; structural ge 95.47
3exn_A160 Probable acetyltransferase; GCN5-related N-acetylt 95.45
4ag7_A165 Glucosamine-6-phosphate N-acetyltransferase; HET: 95.43
2r7h_A177 Putative D-alanine N-acetyltransferase of GNAT FA; 95.43
3d8p_A163 Acetyltransferase of GNAT family; NP_373092.1, str 95.41
1wjq_A107 KIAA1798 protein; MBT domain, structural genomics, 95.39
2cy2_A174 TTHA1209, probable acetyltransferase; structural g 95.38
3fnc_A163 Protein LIN0611, putative acetyltransferase; GNAT, 95.38
3bln_A143 Acetyltransferase GNAT family; NP_981174.1, struct 95.36
3i3g_A161 N-acetyltransferase; malaria, structural genomics, 95.36
1q2y_A140 Protein YJCF, similar to hypothetical proteins; GC 95.35
3jvn_A166 Acetyltransferase; alpha-beta protein, structural 95.29
2dig_A68 Lamin-B receptor; tudor domain, integral nuclear e 95.25
2k5t_A128 Uncharacterized protein YHHK; N-acetyl transferase 95.24
3i9s_A183 Integron cassette protein; oyster POND, woods HOLE 95.18
4evy_A166 Aminoglycoside N(6')-acetyltransferase type 1; cen 95.15
2q0y_A153 GCN5-related N-acetyltransferase; YP_295895.1, ace 95.15
1cjw_A166 Protein (serotonin N-acetyltransferase); HET: COT; 95.15
1y9k_A157 IAA acetyltransferase; structural genomics, midwes 95.12
3s6f_A145 Hypothetical acetyltransferase; acyl-COA N-acyltra 95.02
1z4r_A168 General control of amino acid synthesis protein 5- 95.01
1s3z_A165 Aminoglycoside 6'-N-acetyltransferase; GNAT, amino 94.99
2l8d_A66 Lamin-B receptor; DNA binding protein; NMR {Gallus 94.98
1i12_A160 Glucosamine-phosphate N-acetyltransferase; GNAT, a 94.98
2bei_A170 Diamine acetyltransferase 2; SSAT2, BC011751, AAH1 94.95
3fix_A183 N-acetyltransferase; termoplasma acidophilum, stru 94.92
2bue_A202 AAC(6')-IB; GNAT, transferase, aminoglycoside, flu 94.92
1mk4_A157 Hypothetical protein YQJY; alpha-beta-alpha sandwi 94.92
1xeb_A150 Hypothetical protein PA0115; midwest center for st 94.91
3fyn_A176 Integron gene cassette protein HFX_CASS3; integron 94.91
2aj6_A159 Hypothetical protein MW0638; structural genomics, 94.89
3fdr_A94 Tudor and KH domain-containing protein; TDRD2, str 94.86
1bo4_A168 Protein (serratia marcescens aminoglycoside-3-N- a 94.85
1qsm_A152 HPA2 histone acetyltransferase; protein-acetyl coe 94.85
1ufh_A180 YYCN protein; alpha and beta, fold, acetyltransfer 94.79
3t9y_A150 Acetyltransferase, GNAT family; PSI-biology, struc 94.79
3pnw_C77 Tudor domain-containing protein 3; FAB, structural 94.79
2pdo_A144 Acetyltransferase YPEA; alpha-beta-alpha sandwich, 94.76
1yx0_A159 Hypothetical protein YSNE; NESG, GFT structral gen 94.69
2ldm_A81 Uncharacterized protein; PHF20, tudor domain, epig 93.69
1ghe_A177 Acetyltransferase; acyl coenzyme A complex; HET: A 94.63
2gan_A190 182AA long hypothetical protein; alpha-beta protei 94.56
2o28_A184 Glucosamine 6-phosphate N-acetyltransferase; struc 94.55
3dr6_A174 YNCA; acetyltransferase, csgid target, essential g 94.54
1qst_A160 TGCN5 histone acetyl transferase; GCN5-related N-a 94.54
1wwz_A159 Hypothetical protein PH1933; structural genomics, 94.53
2fe7_A166 Probable N-acetyltransferase; structural genomics, 94.47
2b5g_A171 Diamine acetyltransferase 1; structural genomics, 94.47
2vez_A190 Putative glucosamine 6-phosphate acetyltransferase 94.44
2fia_A162 Acetyltransferase; structural genomics, PSI, prote 94.35
2dxq_A150 AGR_C_4057P, acetyltransferase; structural genomic 94.33
1vkc_A158 Putative acetyl transferase; structural genomics, 94.31
2fiw_A172 GCN5-related N-acetyltransferase:aminotransferase 94.28
1y9w_A140 Acetyltransferase; structural genomics, Pro struct 94.26
3eg7_A176 Spermidine N1-acetyltransferase; structural genomi 94.21
1z4e_A153 Transcriptional regulator; nysgxrc target T2017, G 94.2
2fl4_A149 Spermine/spermidine acetyltransferase; structural 94.2
3f5b_A182 Aminoglycoside N(6')acetyltransferase; APC60744, l 94.17
2cnt_A160 Modification of 30S ribosomal subunit protein S18; 94.1
2q7b_A181 Acetyltransferase, GNAT family; NP_689019.1, struc 94.07
2g3a_A152 Acetyltransferase; structural genomics, PSI, prote 94.06
3ec4_A228 Putative acetyltransferase from the GNAT family; Y 94.03
4e0a_A164 BH1408 protein; structural genomics, PSI-biology, 94.02
2oh1_A179 Acetyltransferase, GNAT family; YP_013287.1, struc 93.98
2qec_A204 Histone acetyltransferase HPA2 and related acetylt 93.91
1ygh_A164 ADA4, protein (transcriptional activator GCN5); tr 93.89
2heo_A67 Z-DNA binding protein 1; protein DLM1-Z-DNA comple 93.86
3f8k_A160 Protein acetyltransferase; GCN5-related N-acetyltr 93.86
3juw_A175 Probable GNAT-family acetyltransferase; structural 93.79
3ld2_A197 SMU.2055, putative acetyltransferase; HET: COA; 2. 93.77
2i79_A172 Acetyltransferase, GNAT family; acetyl coenzyme *A 93.76
2pc1_A201 Acetyltransferase, GNAT family; NP_688560.1, struc 93.75
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 93.72
3d3s_A189 L-2,4-diaminobutyric acid acetyltransferase; alpha 93.71
2pr1_A163 Uncharacterized N-acetyltransferase YLBP; YIBP pro 93.71
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 93.65
2ob0_A170 Human MAK3 homolog; acetyltransferase, structural 93.59
1kux_A207 Aralkylamine, serotonin N-acetyltransferase; enzym 93.54
2diq_A110 Tudor and KH domain-containing protein; tudor doma 93.46
3dsb_A157 Putative acetyltransferase; APC60368.2, ST genomic 93.4
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 93.39
1n71_A180 AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, 93.39
2ae6_A166 Acetyltransferase, GNAT family; GCN5-related N-ace 93.37
3eo4_A164 Uncharacterized protein MJ1062; APC60792.2,MJ_1062 93.28
2ge3_A170 Probable acetyltransferase; structural GEN PSI, pr 93.28
2x7b_A168 N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulf 93.24
1u6m_A199 Acetyltransferase, GNAT family; structural genomic 93.23
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 93.2
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 93.18
2eui_A153 Probable acetyltransferase; dimer, structural geno 93.13
1on0_A158 YYCN protein; structural genomics, alpha-beta prot 93.05
2i6c_A160 Putative acetyltransferase; GNAT family, structura 93.02
3igr_A184 Ribosomal-protein-S5-alanine N-acetyltransferase; 92.93
2q04_A211 Acetoin utilization protein; ZP_00540088.1, struct 92.85
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 92.75
3kkw_A182 Putative uncharacterized protein; acetyltransferas 92.67
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 92.61
3tth_A170 Spermidine N1-acetyltransferase; central intermedi 92.59
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 92.59
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 92.56
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 92.48
3frm_A254 Uncharacterized conserved protein; APC61048, staph 92.38
1yre_A197 Hypothetical protein PA3270; APC5563, midwest cent 92.38
2biv_A243 SCML2 protein, sex COMB on midleg-like protein 2; 92.35
3r9f_A188 MCCE protein; microcin C7, acetyltransferase, SELF 92.32
4h89_A173 GCN5-related N-acetyltransferase; N-acyltransferas 92.26
2kcw_A147 Uncharacterized acetyltransferase YJAB; GNAT fold, 92.26
2z10_A194 Ribosomal-protein-alanine acetyltransferase; alpha 92.19
1xmt_A103 Putative acetyltransferase; structural genomics, p 92.15
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 92.11
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 92.1
2ree_A224 CURA; GNAT, S-acetyltransferase, decarboxylase, po 92.07
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 92.02
1ard_A29 Yeast transcription factor ADR1; transcription reg 92.0
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 91.98
2fsr_A195 Acetyltransferase; alpha-beta-sandwich, structural 91.91
3iwg_A276 Acetyltransferase, GNAT family; structural genomic 91.89
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 91.88
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 91.87
1s7k_A182 Acetyl transferase; GNAT; 1.80A {Salmonella typhim 91.87
3ddd_A288 Putative acetyltransferase; NP_142035.1, structura 91.78
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 91.78
2vi7_A177 Acetyltransferase PA1377; GNAT, GCN5 family, N-ace 91.74
1ri0_A110 Hepatoma-derived growth factor; HDGF, HATH domain, 91.7
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 91.66
3fbu_A168 Acetyltransferase, GNAT family; structur genomics, 91.58
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 90.87
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 91.56
2r1i_A172 GCN5-related N-acetyltransferase; YP_831484.1, put 91.53
3c26_A266 Putative acetyltransferase TA0821; NP_394282.1, A 91.39
2qqr_A118 JMJC domain-containing histone demethylation prote 91.26
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 91.15
1m4i_A181 Aminoglycoside 2'-N-acetyltransferase; COA binding 91.15
4fd4_A217 Arylalkylamine N-acetyltransferase like 5B; GNAT; 91.12
1nsl_A184 Probable acetyltransferase; structural genomics, h 91.09
2j8m_A172 Acetyltransferase PA4866 from P. aeruginosa; GCN5 91.04
1yr0_A175 AGR_C_1654P, phosphinothricin acetyltransferase; s 91.02
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 90.33
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 90.93
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 90.83
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 90.8
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 90.77
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 90.76
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 90.1
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 90.62
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 90.6
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 90.58
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 90.53
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 90.47
4fd5_A222 Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A 90.46
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 90.46
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 90.45
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 90.37
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 90.34
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 90.31
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 90.31
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 90.28
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 90.19
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 90.09
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 90.09
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 90.01
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 89.95
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 89.93
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 89.86
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 89.85
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 89.81
3qb8_A197 A654L protein; GNAT N-acetyltransferase, acetyltra 89.79
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 89.76
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 89.76
2l89_A108 PWWP domain-containing protein 1; histone binding, 89.75
2r58_A265 Polycomb protein SCM; MBT repeat, sex COMB on midl 89.72
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 89.7
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 89.65
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 89.65
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 89.64
3g8w_A169 Lactococcal prophage PS3 protein 05; APC61042, ace 89.63
3jth_A98 Transcription activator HLYU; transcription factor 89.62
2xvc_A59 ESCRT-III, SSO0910; cell cycle, cell division, cyt 89.52
1q1h_A110 TFE, transcription factor E, TFE; TFIIE, transcrip 89.52
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 89.5
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 89.41
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 89.39
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 89.37
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 89.34
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 89.33
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 89.33
3d2m_A456 Putative acetylglutamate synthase; protein-COA-Glu 89.27
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 89.27
2y75_A129 HTH-type transcriptional regulator CYMR; DNA bindi 89.26
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 89.26
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 89.18
4fd7_A238 Putative arylalkylamine N-acetyltransferase 7; GNA 89.13
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 89.03
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 89.0
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 88.99
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 88.98
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 88.97
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 88.97
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 88.97
1vhs_A175 Similar to phosphinothricin acetyltransferase; str 88.94
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 88.92
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 88.9
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 88.9
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 88.89
1r1u_A106 CZRA, repressor protein; zinc, DNA binding, transc 88.87
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 88.86
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 88.86
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 88.8
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 88.8
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 88.79
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 88.7
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 88.68
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 88.61
3cuo_A99 Uncharacterized HTH-type transcriptional regulato; 88.61
3pzj_A209 Probable acetyltransferases; MCSG, PSI-2, structur 88.6
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 88.6
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 88.59
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 88.59
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 88.58
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 88.55
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 88.52
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 88.49
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 88.49
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 88.49
1p0h_A318 Hypothetical protein RV0819; GNAT fold, acetyltran 88.48
2wpx_A 339 ORF14; transferase, acetyl transferase, antibiotic 88.41
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 88.36
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 88.35
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 88.33
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 88.31
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 88.29
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 88.28
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 88.28
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 88.13
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 88.12
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 88.11
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 88.1
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 88.1
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 88.05
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 88.03
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 88.02
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 88.01
3mq0_A 275 Transcriptional repressor of the blcabc operon; he 88.0
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 87.92
3tcv_A246 GCN5-related N-acetyltransferase; GRAM negative co 87.89
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 87.87
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 87.86
2hqx_A246 P100 CO-activator tudor domain; human P100 tudor d 87.86
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 87.84
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 87.81
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 87.79
1y0u_A96 Arsenical resistance operon repressor, putative; s 87.76
1oyi_A82 Double-stranded RNA-binding protein; (alpha+beta) 87.73
2jt1_A77 PEFI protein; solution structure, winged helix-tur 87.7
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 87.68
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 87.64
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 87.63
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 87.6
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 87.6
2jsc_A118 Transcriptional regulator RV1994C/MT2050; cadmium, 87.6
2kko_A108 Possible transcriptional regulatory protein (possi 87.59
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 87.56
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 87.53
1khc_A147 DNA cytosine-5 methyltransferase 3B2; five beta-sh 87.45
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 87.45
3tt2_A330 GCN5-related N-acetyltransferase; structural genom 87.44
2wpx_A339 ORF14; transferase, acetyl transferase, antibiotic 87.4
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 87.38
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 87.38
2qml_A198 BH2621 protein; structural genomics, joint center 87.33
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 87.28
3tt2_A 330 GCN5-related N-acetyltransferase; structural genom 87.28
2lv2_A85 Insulinoma-associated protein 1; structural genomi 87.22
4fu6_A153 PC4 and SFRS1-interacting protein; structural geno 87.2
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 87.12
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 87.07
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 87.05
3dlm_A213 Histone-lysine N-methyltransferase setdb1; setdb1_ 87.05
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 86.9
3pqk_A102 Biofilm growth-associated repressor; helix-turn-he 86.75
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 86.71
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 86.69
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 86.65
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 86.65
3r1k_A 428 Enhanced intracellular surviVal protein; GNAT, ace 86.62
2g7u_A 257 Transcriptional regulator; ICLR family, structural 86.37
1mkm_A 249 ICLR transcriptional regulator; structural genomic 86.36
3qby_A94 Hepatoma-derived growth factor-related protein 2; 86.35
1paa_A30 Yeast transcription factor ADR1; transcription reg 86.3
2oqg_A114 Possible transcriptional regulator, ARSR family P; 86.17
2jlm_A182 Putative phosphinothricin N-acetyltransferase; met 86.16
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 86.0
1u2w_A122 CADC repressor, cadmium efflux system accessory pr 85.97
3ntk_A169 Maternal protein tudor; tudor domain, OB-fold, GER 85.89
2xrn_A 241 HTH-type transcriptional regulator TTGV; DNA-bindi 85.84
3r4k_A 260 Transcriptional regulator, ICLR family; DNA/RNA-bi 85.78
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 85.59
3te4_A215 GH12636P, dopamine N acetyltransferase, isoform A; 85.49
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 85.46
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 85.43
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 85.38
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 85.32
2fck_A181 Ribosomal-protein-serine acetyltransferase, putat; 85.25
3f6o_A118 Probable transcriptional regulator, ARSR family pr 85.22
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 85.21
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 85.21
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 85.16
4b9w_A201 TDRD1, tudor domain-containing protein 1; replicat 85.14
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 85.0
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 84.99
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 84.95
3llr_A154 DNA (cytosine-5)-methyltransferase 3A; DNA methylt 84.89
2daq_A110 WHSC1L1 protein, isoform long; PWWP domain, struct 84.85
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 84.85
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 84.84
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 84.82
1sqh_A312 Hypothetical protein CG14615-PA; structural genomi 84.79
1p0h_A 318 Hypothetical protein RV0819; GNAT fold, acetyltran 84.75
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 84.73
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 84.56
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 84.55
2lv2_A85 Insulinoma-associated protein 1; structural genomi 84.42
2hv2_A 400 Hypothetical protein; PSI, protein structure initi 84.35
2ia2_A 265 Putative transcriptional regulator; SAD, PSI-2, st 84.33
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 84.33
1qbj_A81 Protein (double-stranded RNA specific adenosine D 84.25
1r1t_A122 Transcriptional repressor SMTB; zinc, transcriptio 84.05
2lkp_A119 Transcriptional regulator, ARSR family; symmetric 84.03
3h4q_A188 Putative acetyltransferase; NP_371943.1, structura 84.02
1h3z_A109 Hypothetical 62.8 kDa protein C215.07C; nuclear pr 83.95
3n7z_A 388 Acetyltransferase, GNAT family; PSI2, MCSG, struct 83.76
2xdp_A123 Lysine-specific demethylase 4C; oxidoreductase, hi 83.67
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 83.53
1ub9_A100 Hypothetical protein PH1061; helix-turn-helix moti 83.45
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 83.4
3g3s_A249 GCN5-related N-acetyltransferase; ZP_00874857.1, a 83.13
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 82.72
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 82.62
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 82.57
1oz2_A331 Lethal(3)malignant brain tumor-like protein; prope 82.34
4b9x_A226 TDRD1, tudor domain-containing protein 1; replicat 82.33
2e72_A49 POGO transposable element with ZNF domain; zinc fi 82.2
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 82.09
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 82.09
1oz2_A331 Lethal(3)malignant brain tumor-like protein; prope 81.96
2d1h_A109 ST1889, 109AA long hypothetical transcriptional re 81.76
3f2g_A 220 Alkylmercury lyase; MERB, organomercurial lyase, m 81.69
2ozg_A 396 GCN5-related N-acetyltransferase; YP_325469.1, ace 81.69
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 81.61
2biv_A243 SCML2 protein, sex COMB on midleg-like protein 2; 81.45
2vzy_A218 RV0802C; transferase, GCN5-related N-acetyltransfe 81.33
1yk3_A210 Hypothetical protein RV1347C/MT1389; acyltransfera 81.28
2o0y_A 260 Transcriptional regulator; ICLR-family, structural 81.2
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 81.2
2g0b_A198 FEEM; N-acyl transferase, environmental DNA, prote 81.12
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 80.9
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 80.78
1pfb_A55 Polycomb protein; chromatin, histone methylation, 80.65
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 80.45
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 80.38
3i91_A54 Chromobox protein homolog 8; chromobox homolog 8, 80.3
>3to7_A Histone acetyltransferase ESA1; MYST family; HET: ALY COA; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 3to6_A* 1fy7_A* 1mja_A* 1mjb_A* 3to9_A* 1mj9_A* Back     alignment and structure
Probab=100.00  E-value=9.9e-126  Score=921.95  Aligned_cols=276  Identities=53%  Similarity=0.996  Sum_probs=271.2

Q ss_pred             cccccCCccEEEecceeeecccCCCCCcCcCCCCcEEEeccccccccCHHHHHHHHhhCCCCCCCccEEEecCCeEEEEE
Q 013121          171 EFTKVKNIATIELGRYEIETWYFSPFPPEYNDCLKLYFCEFCLNFMKRKEQLQRHMRKCDLKHPPGDEIYRSGTLSMFEV  250 (449)
Q Consensus       171 ~~t~~rni~~I~~G~y~i~tWY~SPYP~e~~~~~~lyiCe~Cl~y~~~~~~l~~H~~~C~~~~PPG~eIYr~~~isifEV  250 (449)
                      |+|++|||++|+||+|+|+||||||||+||.+.++||||||||+||+++.+|.+|+.+|.++||||+||||++++|||||
T Consensus         1 e~tkvkni~~i~~G~~~i~tWY~SPyP~e~~~~~~lyiCe~ClkY~~~~~~~~~H~~~C~~r~PPG~eIYR~~~~svfEV   80 (276)
T 3to7_A            1 EVARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEI   80 (276)
T ss_dssp             CCCCCCCCCEEEETTEEECCSSCCCCCCCCCSCCEEEECTTTCCEESSHHHHHHHHTSCCCSSCSSEEEEECSSEEEEEE
T ss_pred             CcceecccCEEEECCEEEEeeeCCCCcHHhcCCCeEEEccchhhhcCCHHHHHHHhccCCCcCCCCceEEECCCEEEEEE
Confidence            57899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eCccCcchhhhhhHHhhhhcccccceecCCCceEEEEEEecCCCceeeeeecccccCCCCceeeEEeecCcccccccchh
Q 013121          251 DGKKNKVYGQNLCYLAKLFLDHKTLYYDVDLFLFYVLCECDDRGCHMVGYFSKEKHSEESYNLACILTLPPYQRKGYGKF  330 (449)
Q Consensus       251 DG~~~k~yCQnLCLlaKLFLdhKTlyyDV~~FlFYVl~e~d~~g~h~vGYFSKEK~s~~~~NLaCIl~lP~yQrkGyG~~  330 (449)
                      ||+++++|||||||||||||||||||||||+|+|||||+.|+.|+|+||||||||.|+++||||||||||||||||||+|
T Consensus        81 DG~~~k~yCQnLcLlaKLFLdhKtlyyDV~~F~FYVl~e~d~~g~h~vGyFSKEK~s~~~~NLaCIltlP~yQrkGyG~l  160 (276)
T 3to7_A           81 DGRKQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVACILTLPQYQRMGYGKL  160 (276)
T ss_dssp             EGGGSHHHHHHHHHHHHTTCSCCSCTTCCTTEEEEEEEEEETTEEEEEEEEEEESSCTTCEEESCEEECGGGTTSSHHHH
T ss_pred             eCCcchHHHHHHHHHHHHhhccceeeeeCCCeEEEEEEEeCCCCceecccccccccccCCCeEEEEEecChHHcCCccce
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhhchhhhhccCCCCCCCccCChhhhhHHHhhhHHHHHHHHHhCCCCccHHHHHHhcCCChHHHHHHHHhcCceeeeCC
Q 013121          331 LIAFSYELSKKEGKVGTPERPLSDLGLLSYRGYWTRVLLDILKKHKGNISIKELSDMTAIKAEDILTTLQSLELIQYRKG  410 (449)
Q Consensus       331 LI~fSYeLSr~E~~~G~PErPLSDLG~~sY~sYW~~~il~~L~~~~~~isi~~is~~Tgi~~~DIi~tL~~l~ll~~~~g  410 (449)
                      ||+|||+|||+||++|||||||||||++||++||+++|+++|.+++..|||+|||++|||+++||++||++||||++++|
T Consensus       161 LI~fSYeLSr~Eg~~G~PEkPLSdLG~~sY~~YW~~~i~~~L~~~~~~isi~~is~~Tgi~~~Dii~tL~~l~~l~~~kg  240 (276)
T 3to7_A          161 LIEFSYELSKKENKVGSPEKPLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKG  240 (276)
T ss_dssp             HHHHHHHHHHHTTCCBEECSSCCHHHHHHHHHHHHHHHHHHHHHTCSEEEHHHHHHHHCBCHHHHHHHHHHTTCEEEETT
T ss_pred             eehheeeeeeccCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHhcCCceeHHHHHHHhCCCHHHHHHHHHHCCCEEEeCC
Confidence            99999999999999999999999999999999999999999999888999999999999999999999999999999999


Q ss_pred             eEEEEeCHHHHHHHHHHhcCCCceeeCCCceEecCC
Q 013121          411 QHVICADPKVLDRHLKAAGRGGLEVDVSKLIWTPYK  446 (449)
Q Consensus       411 ~~~i~~~~~~i~~~~~~~~~~~~~id~~~L~W~P~~  446 (449)
                      +|+|++++++++++.+...++++.|||++|+|+|+.
T Consensus       241 ~~~i~~~~~~~~~~~k~~~k~~~~idp~~L~W~P~~  276 (276)
T 3to7_A          241 QHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPPV  276 (276)
T ss_dssp             EEEEECCHHHHHHHHHHHHTCCCCCCGGGBCCCCCC
T ss_pred             cEEEEECHHHHHHHHHHhcCCCcEEchhhceecCCC
Confidence            999999999999988877788899999999999974
>2ou2_A Histone acetyltransferase htatip; structural genomics, structural genomics consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} Back     alignment and structure
>2pq8_A Probable histone acetyltransferase MYST1; MOF, structural genomics, structural genomics consortium, SGC; HET: COA; 1.45A {Homo sapiens} PDB: 2giv_A* 3qah_A* 2y0m_A* 3toa_A* 3tob_A* Back     alignment and structure
>2ozu_A Histone acetyltransferase MYST3; structural genomics, structural G consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} SCOP: d.108.1.1 PDB: 2rc4_A* 1m36_A Back     alignment and structure
>1wgs_A MYST histone acetyltransferase 1; tudor domain, MYST family, struct genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.34.13.3 Back     alignment and structure
>2p0w_A Histone acetyltransferase type B catalytic subuni; HAT1, structural genomics, structural genomics consortium, S transferase; HET: ACO; 1.90A {Homo sapiens} Back     alignment and structure
>2rnz_A Histone acetyltransferase ESA1; HAT, chromodomain, tudor domain, RNA binding, activator, chromatin regulator, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ro0_A Histone acetyltransferase ESA1; HAT, chromodomain, tudor domain, RNA binding, activator, chromatin regulator, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2eko_A Histone acetyltransferase htatip; chromo domain, histone tail, chromatin organization modifier, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lcc_A AT-rich interactive domain-containing protein 4A; chromobarrel domain, RBBP1, transcription; NMR {Homo sapiens} Back     alignment and structure
>2bud_A Males-absent on the first protein; transferase, MOF, HAT, acetyl-transfer, dosage compensation complex, DCC, royal family; NMR {Drosophila melanogaster} SCOP: b.34.13.3 Back     alignment and structure
>2f5k_A MORF-related gene 15 isoform 1; beta barrel, gene regulation; 2.20A {Homo sapiens} SCOP: b.34.13.3 PDB: 2efi_A Back     alignment and structure
>2lrq_A Protein MRG15, NUA4 complex subunit EAF3 homolog; epigenetics, LID complex, transcription; NMR {Drosophila melanogaster} Back     alignment and structure
>3oa6_A MALE-specific lethal 3 homolog; chromodomain, MSL3, histone H4 tail, DNA backbone recognitio methyllysine recognition, H4K20ME1; HET: DNA MLZ; 2.35A {Homo sapiens} PDB: 3ob9_A* Back     alignment and structure
>3m9q_A Protein MALE-specific lethal-3; chromodomain, MSL3, methyllysine recognition, aromatic CAGE, complex, transcription upregulation; 1.29A {Drosophila melanogaster} SCOP: b.34.13.0 Back     alignment and structure
>2k3y_A Chromatin modification-related protein EAF3; dimethylated histone H3K36, EAF3-H3K36ME2 fusion, chromo barrel domain, histone deacetylase; HET: M2L; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3e9g_A Chromatin modification-related protein EAF3; chromatin remodeling, chromo domain, transcription factor, transcription regulation; 2.50A {Saccharomyces cerevisiae} PDB: 2k3x_A 3e9f_A* Back     alignment and structure
>1bob_A HAT1, histone acetyltransferase; histone modification, acetyl coenzyme A binding-protein; HET: ACO; 2.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 Back     alignment and structure
>2eqm_A PHD finger protein 20-like 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2jtf_A Back     alignment and structure
>3sd4_A PHD finger protein 20; tudor domain, transcription; 1.93A {Homo sapiens} PDB: 3q1j_A Back     alignment and structure
>3h8z_A FragIle X mental retardation syndrome-related Pro; tudor domains, FXR2, structura genomics, structural genomics consortium, SGC; 1.92A {Homo sapiens} PDB: 3o8v_A 3kuf_A 2bkd_N* Back     alignment and structure
>4hcz_A PHD finger protein 1; protein-peptide complex, tudor, histone binding, H3K36ME3, N nucleus, transcription; HET: M3L; 1.85A {Homo sapiens} Back     alignment and structure
>4a4f_A SurviVal of motor neuron-related-splicing factor; RNA binding protein; HET: 2MR; NMR {Homo sapiens} PDB: 4a4h_A* Back     alignment and structure
>2e5p_A Protein PHF1, PHD finger protein 1; tudor domain, PHF1 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eqj_A Metal-response element-binding transcription factor 2; structure genomics,tudor domain, zinc-regulated factor 1, ZIRF1; NMR {Mus musculus} Back     alignment and structure
>2xk0_A Polycomb protein PCL; transcription, aromatic CAGE; NMR {Drosophila melanogaster} Back     alignment and structure
>1mhn_A SurviVal motor neuron protein; SMN, SMA, spinal muscular atrophy, RNA binding protein; 1.80A {Homo sapiens} SCOP: b.34.9.1 PDB: 4a4e_A* 4a4g_A* Back     alignment and structure
>2e5q_A PHD finger protein 19; tudor domain, isoform B, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0o_A PHD finger protein 1; tudor domain, H3K36ME3 binding, peptide binding protein; HET: M3L; NMR {Homo sapiens} Back     alignment and structure
>2equ_A PHD finger protein 20-like 1; tudor domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3efa_A Putative acetyltransferase; structural genom 2, protein structure initiative, midwest center for structu genomics, MCSG; 2.42A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3s6w_A Tudor domain-containing protein 3; methylated arginine recognize, ISO-propanol, transcri; 1.78A {Homo sapiens} PDB: 3pmt_A* Back     alignment and structure
>3p8d_A Medulloblastoma antigen MU-MB-50.72; tudor domain, lysine-methylated P53 binding, histone binding binding; 2.00A {Homo sapiens} Back     alignment and structure
>2atr_A Acetyltransferase, GNAT family; MCSG, structural genomics, PSI, protein structure INIT midwest center for structural genomics; 2.01A {Streptococcus pneumoniae} SCOP: d.108.1.1 Back     alignment and structure
>3gy9_A GCN5-related N-acetyltransferase; YP_001815201.1, putative acetyltransferase; HET: MSE COA SO4; 1.52A {Exiguobacterium sibiricum 255-15} PDB: 3gya_A* Back     alignment and structure
>1y7r_A Hypothetical protein SA2161; structural genomics, protein structure initiative, PSI, midwest center for structural genomics; 1.70A {Staphylococcus aureus} SCOP: d.108.1.1 Back     alignment and structure
>2d9t_A Tudor domain-containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.34.9.1 Back     alignment and structure
>1g5v_A SurviVal motor neuron protein 1; mRNA processing, translation; NMR {Homo sapiens} SCOP: b.34.9.1 Back     alignment and structure
>3e0k_A Amino-acid acetyltransferase; N-acetylglutamate synthase, structu genomics, PSI-2, protein structure initiative; HET: MSE; 2.52A {Vibrio parahaemolyticus} Back     alignment and structure
>3qii_A PHD finger protein 20; tudor domain, structural genomics, structural GE consortium, SGC, transcription regulator; 2.30A {Homo sapiens} Back     alignment and structure
>1r57_A Conserved hypothetical protein; GCN5, N-acetyltransferase, structural genomics, PSI, protein structure initiative; NMR {Staphylococcus aureus} SCOP: d.108.1.1 PDB: 2h5m_A* Back     alignment and structure
>3t90_A Glucose-6-phosphate acetyltransferase 1; GNAT fold, glcnac biosynthesis, alpha/beta protein; HET: EPE; 1.50A {Arabidopsis thaliana} Back     alignment and structure
>3pp9_A Putative streptothricin acetyltransferase; toxin production resistance, infectious diseases, structural genomics; HET: MSE ACO; 1.60A {Bacillus anthracis} Back     alignment and structure
>1yvk_A Hypothetical protein BSU33890; ALPHS-beta protein, structural genomics, PSI, protein structure initiative; HET: COA; 3.01A {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>3lod_A Putative acyl-COA N-acyltransferase; structural genomics, PSI2, MCSG, structure initiative; 2.50A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1tiq_A Protease synthase and sporulation negative regulatory protein PAI 1; alpha-beta protein, structural genomics, PSI; HET: COA; 1.90A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>2ozh_A Hypothetical protein XCC2953; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.40A {Xanthomonas campestris PV} Back     alignment and structure
>3owc_A Probable acetyltransferase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: COA; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>3mgd_A Predicted acetyltransferase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; HET: ACO; 1.90A {Clostridium acetobutylicum} Back     alignment and structure
>2jdc_A Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1.6A {Bacillus licheniformis} SCOP: d.108.1.1 PDB: 2bsw_A* 2jdd_A* Back     alignment and structure
>3ey5_A Acetyltransferase-like, GNAT family; structural genomics, APC60148, GNAT famil protein structure initiative; 2.15A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3exn_A Probable acetyltransferase; GCN5-related N-acetyltransferase, MCSG, P structural genomics, protein structure initiative; HET: ACO; 1.80A {Thermus thermophilus} Back     alignment and structure
>4ag7_A Glucosamine-6-phosphate N-acetyltransferase; HET: COA; 1.55A {Caenorhabditis elegans} PDB: 4ag9_A* Back     alignment and structure
>2r7h_A Putative D-alanine N-acetyltransferase of GNAT FA; putative acetyltransferase of the GNAT family; 1.85A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>3d8p_A Acetyltransferase of GNAT family; NP_373092.1, structural GE joint center for structural genomics, JCSG, protein structu initiative; 2.20A {Staphylococcus aureus subsp} Back     alignment and structure
>1wjq_A KIAA1798 protein; MBT domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.9.3 Back     alignment and structure
>2cy2_A TTHA1209, probable acetyltransferase; structural genomics, unknown function, NPPSFA; HET: ACO; 2.00A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 1wk4_A* Back     alignment and structure
>3fnc_A Protein LIN0611, putative acetyltransferase; GNAT, RIMI, structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.75A {Listeria innocua} SCOP: d.108.1.0 Back     alignment and structure
>3bln_A Acetyltransferase GNAT family; NP_981174.1, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE MRD GOL; 1.31A {Bacillus cereus} Back     alignment and structure
>3i3g_A N-acetyltransferase; malaria, structural genomics, structural genomics consortium, SGC,; 1.86A {Trypanosoma brucei} PDB: 3fb3_A Back     alignment and structure
>1q2y_A Protein YJCF, similar to hypothetical proteins; GCN5-related N-acetyltransferase superfamily fold, NYSGXRC, PSI, protein structure initiative; 2.00A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>3jvn_A Acetyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.61A {Vibrio fischeri} Back     alignment and structure
>2dig_A Lamin-B receptor; tudor domain, integral nuclear envelope inner membrane protein, nuclear protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.9.1 Back     alignment and structure
>2k5t_A Uncharacterized protein YHHK; N-acetyl transferase, COA, bound ligand, coenzyme A, structural genomics, PSI-2, protein structure initiative; HET: COA; NMR {Escherichia coli K12} Back     alignment and structure
>3i9s_A Integron cassette protein; oyster POND, woods HOLE, acetyltransferase, structural genomics, PSI-2, protein structure initiative; 2.20A {Vibrio cholerae} Back     alignment and structure
>4evy_A Aminoglycoside N(6')-acetyltransferase type 1; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: TOY; 1.77A {Acinetobacter haemolyticus} PDB: 4f0y_A 4e8o_A Back     alignment and structure
>2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics, joint center for ST genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134} Back     alignment and structure
>1cjw_A Protein (serotonin N-acetyltransferase); HET: COT; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1b6b_A Back     alignment and structure
>1y9k_A IAA acetyltransferase; structural genomics, midwest center for structural genomics bacillus cereus ATCC 14579, PSI; 2.39A {Bacillus cereus atcc 14579} SCOP: d.108.1.1 Back     alignment and structure
>3s6f_A Hypothetical acetyltransferase; acyl-COA N-acyltransferases, structural genomics, joint CENT structural genomics, JCSG; HET: MSE COA; 1.19A {Deinococcus radiodurans} Back     alignment and structure
>1z4r_A General control of amino acid synthesis protein 5-like 2; GCN5, acetyltransferase, SGC, structural genomics, structural genomics consortium; HET: ACO; 1.74A {Homo sapiens} SCOP: d.108.1.1 PDB: 1cm0_B* Back     alignment and structure
>1s3z_A Aminoglycoside 6'-N-acetyltransferase; GNAT, aminoglycoside ribostamycin; HET: COA RIO; 2.00A {Salmonella enteritidis} SCOP: d.108.1.1 PDB: 1s5k_A* 1s60_A* 2vbq_A* Back     alignment and structure
>2l8d_A Lamin-B receptor; DNA binding protein; NMR {Gallus gallus} Back     alignment and structure
>1i12_A Glucosamine-phosphate N-acetyltransferase; GNAT, alpha/beta; HET: ACO; 1.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1i1d_A* 1i21_A Back     alignment and structure
>2bei_A Diamine acetyltransferase 2; SSAT2, BC011751, AAH11751, thialysine N-acetyltransferase, structural genomics, protein structure initiative, PSI; HET: ACO; 1.84A {Homo sapiens} SCOP: d.108.1.1 PDB: 2q4v_A* Back     alignment and structure
>3fix_A N-acetyltransferase; termoplasma acidophilum, structural GEN PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.30A {Thermoplasma acidophilum} PDB: 3f0a_A* 3k9u_A* 3ne7_A* Back     alignment and structure
>2bue_A AAC(6')-IB; GNAT, transferase, aminoglycoside, fluoroquinolone, acetyltransferase, antibiotic resistance; HET: COA RIO; 1.7A {Escherichia coli} PDB: 1v0c_A* 2vqy_A* 2prb_A* 2qir_A* 2pr8_A* Back     alignment and structure
>1mk4_A Hypothetical protein YQJY; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>1xeb_A Hypothetical protein PA0115; midwest center for structural genomics, MCSG, structural GEN protein structure initiative, PSI, APC22065; 2.35A {Pseudomonas aeruginosa} SCOP: d.108.1.1 Back     alignment and structure
>3fyn_A Integron gene cassette protein HFX_CASS3; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.45A {Uncultured bacterium} Back     alignment and structure
>2aj6_A Hypothetical protein MW0638; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.63A {Staphylococcus aureus subsp} SCOP: d.108.1.1 Back     alignment and structure
>3fdr_A Tudor and KH domain-containing protein; TDRD2, structural genomics, structural genomics consortium, SGC, alternative splicing, RNA-binding; 1.75A {Homo sapiens} SCOP: b.34.9.1 Back     alignment and structure
>1bo4_A Protein (serratia marcescens aminoglycoside-3-N- acetyltransferase); eubacterial aminoglyco resistance, GCN5-related N-acetyltransferase; HET: SPD COA; 2.30A {Serratia marcescens} SCOP: d.108.1.1 Back     alignment and structure
>1qsm_A HPA2 histone acetyltransferase; protein-acetyl coenzyme A complex; HET: ACO; 2.40A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1qso_A Back     alignment and structure
>1ufh_A YYCN protein; alpha and beta, fold, acetyltransferase, structural genomics, PSI, protein structure initiative; 2.20A {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>3t9y_A Acetyltransferase, GNAT family; PSI-biology, structural genomics, midwest center for structu genomics, MCSG; HET: PGE; 2.00A {Staphylococcus aureus} Back     alignment and structure
>3pnw_C Tudor domain-containing protein 3; FAB, structural genomics consortium, antibody, SGC, protein immune system complex; 2.05A {Homo sapiens} Back     alignment and structure
>2pdo_A Acetyltransferase YPEA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 2.00A {Shigella flexneri 2A} Back     alignment and structure
>1yx0_A Hypothetical protein YSNE; NESG, GFT structral genomics, SR220, structural genomics, PSI, protein structure initiative; NMR {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>2ldm_A Uncharacterized protein; PHF20, tudor domain, epigenetics, methylated P53, transcript factor, transcription-protein binding complex; HET: M2L; NMR {Homo sapiens} Back     alignment and structure
>1ghe_A Acetyltransferase; acyl coenzyme A complex; HET: ACO; 1.55A {Pseudomonas syringae PV} SCOP: d.108.1.1 PDB: 1j4j_A* Back     alignment and structure
>2gan_A 182AA long hypothetical protein; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.10A {Pyrococcus horikoshii} SCOP: d.108.1.1 Back     alignment and structure
>2o28_A Glucosamine 6-phosphate N-acetyltransferase; structural genomics, structural genomics consortium, SGC; HET: 16G COA; 1.80A {Homo sapiens} PDB: 2huz_A* 3cxq_A* 3cxs_A 3cxp_A Back     alignment and structure
>3dr6_A YNCA; acetyltransferase, csgid target, essential gene, IDP00086, structural genomics, center for STRU genomics of infectious diseases; HET: MSE; 1.75A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 3dr8_A* Back     alignment and structure
>1qst_A TGCN5 histone acetyl transferase; GCN5-related N-acetyltransferase, COA binding protein; HET: EPE; 1.70A {Tetrahymena thermophila} SCOP: d.108.1.1 PDB: 1m1d_A* 1pu9_A* 1pua_A* 5gcn_A* 1qsr_A* 1q2d_A* 1q2c_A* 1qsn_A* Back     alignment and structure
>1wwz_A Hypothetical protein PH1933; structural genomics, pyrococcus horikoshii OT3, riken struct genomics/proteomics initiative, RSGI; HET: ACO; 1.75A {Pyrococcus horikoshii} SCOP: d.108.1.1 Back     alignment and structure
>2fe7_A Probable N-acetyltransferase; structural genomics, pseudomonas aerugi PSI, protein structure initiative; 2.00A {Pseudomonas aeruginosa ucbpp-pa14} SCOP: d.108.1.1 Back     alignment and structure
>2b5g_A Diamine acetyltransferase 1; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: ALY; 1.70A {Homo sapiens} SCOP: d.108.1.1 PDB: 2b4d_A* 2jev_A* 2g3t_A 2f5i_A 2b3u_A 2b3v_A* 2b4b_A* 2b58_A* 2fxf_A* 3bj7_A* 3bj8_A* Back     alignment and structure
>2vez_A Putative glucosamine 6-phosphate acetyltransferase; acyltransferase; HET: ACO G6P; 1.45A {Aspergillus fumigatus} PDB: 2vxk_A* Back     alignment and structure
>2fia_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 2.60A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>2dxq_A AGR_C_4057P, acetyltransferase; structural genomics, PSI-2, protein struc initiative, midwest center for structural genomics, MCSG; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>1vkc_A Putative acetyl transferase; structural genomics, pyrococcus furiosus southeast collaboratory for structural genomics, secsg; 1.89A {Pyrococcus furiosus} SCOP: d.108.1.1 Back     alignment and structure
>2fiw_A GCN5-related N-acetyltransferase:aminotransferase II; alpha-beta-alpha sandwich, GCN4-related acetyltransferase, S genomics, PSI; HET: ACO; 2.35A {Rhodopseudomonas palustris} SCOP: d.108.1.1 Back     alignment and structure
>1y9w_A Acetyltransferase; structural genomics, Pro structure initiative, PSI, midwest center for structural GE MCSG; 1.90A {Bacillus cereus} SCOP: d.108.1.1 Back     alignment and structure
>3eg7_A Spermidine N1-acetyltransferase; structural genomics, IDP016 transferase, center for structural genomics of infectious D csgid; HET: MSE; 2.38A {Vibrio cholerae} SCOP: d.108.1.0 Back     alignment and structure
>1z4e_A Transcriptional regulator; nysgxrc target T2017, GNAT fold, structural genomics, PSI, P structure initiative; 2.00A {Bacillus halodurans} SCOP: d.108.1.1 Back     alignment and structure
>2fl4_A Spermine/spermidine acetyltransferase; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>3f5b_A Aminoglycoside N(6')acetyltransferase; APC60744, legionella pneumophila subsp. pneumophila, structural genomics, PSI-2; HET: MSE; 2.00A {Legionella pneumophila subsp} Back     alignment and structure
>2cnt_A Modification of 30S ribosomal subunit protein S18; N-alpha acetylation, GCN5-N-acetyltransferase, ribosomal Pro acetyltransferase, GNAT; HET: COA; 2.4A {Salmonella typhimurium} PDB: 2cnm_A* 2cns_A* Back     alignment and structure
>2q7b_A Acetyltransferase, GNAT family; NP_689019.1, structural GEN joint center for structural genomics, JCSG; HET: MSE FLC; 2.00A {Streptococcus agalactiae 2603V} Back     alignment and structure
>2g3a_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 1.90A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>3ec4_A Putative acetyltransferase from the GNAT family; YP_497011.1, joint center for structural genomics; 1.80A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Back     alignment and structure
>4e0a_A BH1408 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, transferase; 1.80A {Bacillus halodurans} PDB: 4f6a_A* Back     alignment and structure
>2oh1_A Acetyltransferase, GNAT family; YP_013287.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE UNL; 1.46A {Listeria monocytogenes str} Back     alignment and structure
>2qec_A Histone acetyltransferase HPA2 and related acetyltransferases; NP_600742.1, acetyltransferase (GNAT) family; 1.90A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1ygh_A ADA4, protein (transcriptional activator GCN5); transcriptional regulation, histone acetylation; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 Back     alignment and structure
>2heo_A Z-DNA binding protein 1; protein DLM1-Z-DNA complex, immune system-DNA complex; 1.70A {Mus musculus} PDB: 1j75_A Back     alignment and structure
>3f8k_A Protein acetyltransferase; GCN5-related N-acetyltransferase; HET: COA; 1.84A {Sulfolobus solfataricus P2} Back     alignment and structure
>3juw_A Probable GNAT-family acetyltransferase; structural genomics, APC60242, acetyltransferas protein structure initiative; HET: MSE; 2.11A {Bordetella pertussis} Back     alignment and structure
>3ld2_A SMU.2055, putative acetyltransferase; HET: COA; 2.50A {Streptococcus mutans} Back     alignment and structure
>2i79_A Acetyltransferase, GNAT family; acetyl coenzyme *A, structur genomics, PSI-2, protein structure initiative; HET: ACO; 2.10A {Streptococcus pneumoniae} Back     alignment and structure
>2pc1_A Acetyltransferase, GNAT family; NP_688560.1, structural genom joint center for structural genomics, JCSG; HET: MSE; 1.28A {Streptococcus agalactiae 2603V} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>3d3s_A L-2,4-diaminobutyric acid acetyltransferase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 1.87A {Bordetella parapertussis 12822} Back     alignment and structure
>2pr1_A Uncharacterized N-acetyltransferase YLBP; YIBP protein, coenzyme A, structural GE PSI-2, protein structure initiative; HET: SUC COA; 3.20A {Bacillus subtilis} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ob0_A Human MAK3 homolog; acetyltransferase, structural genomics consortium, SGC; HET: ACO; 1.80A {Homo sapiens} PDB: 2psw_A* 3tfy_A* Back     alignment and structure
>1kux_A Aralkylamine, serotonin N-acetyltransferase; enzyme-inhibitor complex, bisubstrate analog, alternate conformations; HET: CA3; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1kuv_A* 1kuy_A* 1l0c_A* 1ib1_E* Back     alignment and structure
>2diq_A Tudor and KH domain-containing protein; tudor domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.34.9.1 Back     alignment and structure
>3dsb_A Putative acetyltransferase; APC60368.2, ST genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 1.48A {Clostridium difficile} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1n71_A AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, antibiotic resistance, coenzyme A; HET: COA; 1.80A {Enterococcus faecium} SCOP: d.108.1.1 PDB: 2a4n_A* 1b87_A* Back     alignment and structure
>2ae6_A Acetyltransferase, GNAT family; GCN5-related N-acetyltransferase (GNAT), alpha-beta, structu genomics, PSI, protein structure initiative; HET: GOL; 2.19A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>3eo4_A Uncharacterized protein MJ1062; APC60792.2,MJ_1062,methanocaldococcus jannaschii DSM 2661, S genomics, PSI-2; HET: MES PG6; 2.19A {Methanocaldococcus jannaschii} Back     alignment and structure
>2ge3_A Probable acetyltransferase; structural GEN PSI, protein structure initiative, midwest center for struc genomics, MCSG; HET: ACO; 2.25A {Agrobacterium tumefaciens} SCOP: d.108.1.1 Back     alignment and structure
>2x7b_A N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulfolobus solfataricus} Back     alignment and structure
>1u6m_A Acetyltransferase, GNAT family; structural genomics, PSI, protein structure initiative; 2.40A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2eui_A Probable acetyltransferase; dimer, structural genomics, PSI, protein structure initiative; 2.80A {Pseudomonas aeruginosa PAO1} SCOP: d.108.1.1 Back     alignment and structure
>1on0_A YYCN protein; structural genomics, alpha-beta protein with anti-parallel B strands, PSI, protein structure initiative; 2.20A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>2i6c_A Putative acetyltransferase; GNAT family, structural genomic, structur genomics, PSI-2, protein structure initiative; HET: MSE EPE; 1.30A {Pseudomonas aeruginosa} SCOP: d.108.1.1 PDB: 3pgp_A* Back     alignment and structure
>3igr_A Ribosomal-protein-S5-alanine N-acetyltransferase; fisch MCSG, structural genomics, midwest center for structural GE protein structure initiative; HET: MSE; 2.00A {Vibrio fischeri} SCOP: d.108.1.0 Back     alignment and structure
>2q04_A Acetoin utilization protein; ZP_00540088.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.33A {Exiguobacterium sibiricum} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>3kkw_A Putative uncharacterized protein; acetyltransferase, GNAT family, structural genomics, PSI, protein structure initiative; 1.41A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3tth_A Spermidine N1-acetyltransferase; central intermediary metabolism; 3.30A {Coxiella burnetii} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>3frm_A Uncharacterized conserved protein; APC61048, staphylococcus epidermidis ATCC structural genomics, PSI-2, protein structure initiative; HET: MES; 2.32A {Staphylococcus epidermidis} Back     alignment and structure
>1yre_A Hypothetical protein PA3270; APC5563, midwest center for structural genomics, MSC protein structure initiative, PSI, MCSG; HET: COA; 2.15A {Pseudomonas aeruginosa} SCOP: d.108.1.1 Back     alignment and structure
>2biv_A SCML2 protein, sex COMB on midleg-like protein 2; MBT, malignant brain tumor, transcription factor; 1.7A {Homo sapiens} SCOP: b.34.9.3 b.34.9.3 PDB: 1oi1_A 2vyt_A* 2p0k_A Back     alignment and structure
>3r9f_A MCCE protein; microcin C7, acetyltransferase, SELF immunity, resistance, A coenzyme A, transferase; HET: COA GSU; 1.20A {Escherichia coli} PDB: 3r95_A* 3r96_A* 3r9e_A* 3r9g_A* Back     alignment and structure
>4h89_A GCN5-related N-acetyltransferase; N-acyltransferase superfamily, structural genomics, PSI-BIOL midwest center for structural genomics, MCSG; 1.37A {Kribbella flavida} Back     alignment and structure
>2kcw_A Uncharacterized acetyltransferase YJAB; GNAT fold, acyltransferase; NMR {Escherichia coli} Back     alignment and structure
>2z10_A Ribosomal-protein-alanine acetyltransferase; alpha/beta protein, acyltransferase, structural genomics, NPPSFA; HET: IYR; 1.77A {Thermus thermophilus} PDB: 2z0z_A* 2z11_A* 2zxv_A* Back     alignment and structure
>1xmt_A Putative acetyltransferase; structural genomics, protein structure initiative, CESG, AT1G77540, center for eukaryotic structural genomics; 1.15A {Arabidopsis thaliana} SCOP: d.108.1.1 PDB: 2q44_A 2evn_A 2il4_A* 2q4y_A* Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ree_A CURA; GNAT, S-acetyltransferase, decarboxylase, polyketid synthase, loading, phosphopantetheine, transferase, lyase; HET: SO4; 1.95A {Lyngbya majuscula} PDB: 2ref_A* Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fsr_A Acetyltransferase; alpha-beta-sandwich, structural genomics, PSI, protein struc initiative, midwest center for structural genomics; HET: PEG; 1.52A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.30A {Colwellia psychrerythraea} Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1s7k_A Acetyl transferase; GNAT; 1.80A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 1s7l_A* 1s7n_A* 1s7f_A 1z9u_A Back     alignment and structure
>3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2vi7_A Acetyltransferase PA1377; GNAT, GCN5 family, N-acetyltransferase, hypothetical protein; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>1ri0_A Hepatoma-derived growth factor; HDGF, HATH domain, PWWP domain, heparin-binding, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.9.2 PDB: 2b8a_A 2nlu_A Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>3fbu_A Acetyltransferase, GNAT family; structur genomics, PSI2, MCSG, protein structure initiative, midwest for structural genomics; HET: COA; 1.80A {Bacillus anthracis str} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2r1i_A GCN5-related N-acetyltransferase; YP_831484.1, putative acetyltransferase, arthrobacter SP. FB acetyltransferase (GNAT) family; HET: MSE; 1.65A {Arthrobacter SP} Back     alignment and structure
>3c26_A Putative acetyltransferase TA0821; NP_394282.1, A putative acetyltransferase, acetyltransferase family, structural genomics; 2.00A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>2qqr_A JMJC domain-containing histone demethylation protein 3A; histone lysine demethylase, tandem hybrid tudor domains, metal binding protein; 1.80A {Homo sapiens} SCOP: b.34.9.1 b.34.9.1 PDB: 2qqs_A* 2gfa_A* 2gf7_A* Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1m4i_A Aminoglycoside 2'-N-acetyltransferase; COA binding motif; HET: COA KAN PAP; 1.50A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1m4d_A* 1m4g_A* 1m44_A* Back     alignment and structure
>4fd4_A Arylalkylamine N-acetyltransferase like 5B; GNAT; 1.95A {Aedes aegypti} Back     alignment and structure
>1nsl_A Probable acetyltransferase; structural genomics, hexamer, alpha-beta, PSI, protein struc initiative, midwest center for structural genomics; 2.70A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>2j8m_A Acetyltransferase PA4866 from P. aeruginosa; GCN5 family, phosphinothricin, methionine sulfone, methionine sulfoximine; 1.44A {Pseudomonas aeruginosa} PDB: 2bl1_A 2j8n_A 2j8r_A* 1yvo_A Back     alignment and structure
>1yr0_A AGR_C_1654P, phosphinothricin acetyltransferase; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.00A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>4fd5_A Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A {Aedes aegypti} PDB: 4fd6_A Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>3qb8_A A654L protein; GNAT N-acetyltransferase, acetyltransferase, COA, spermine, spermidine, transferase; HET: COA; 1.50A {Paramecium bursaria chlorella virus 1} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2l89_A PWWP domain-containing protein 1; histone binding, protein binding; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2r58_A Polycomb protein SCM; MBT repeat, sex COMB on midleg, DI-methyl lysine, regulator, developmental protein, metal-binding, nucleus; HET: MLY; 2.00A {Drosophila melanogaster} PDB: 2r57_A* 2r5a_A* 2r5m_A* Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>3g8w_A Lactococcal prophage PS3 protein 05; APC61042, acetyltransferase, staphylococcus epidermidis ATCC structural genomics; HET: NHE FLC; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>3jth_A Transcription activator HLYU; transcription factor, RTXA, DNA-binding, transcription regulation; 2.00A {Vibrio vulnificus} Back     alignment and structure
>2xvc_A ESCRT-III, SSO0910; cell cycle, cell division, cytokinesis, winged-helix; 2.15A {Sulfolobus solfataricus} Back     alignment and structure
>1q1h_A TFE, transcription factor E, TFE; TFIIE, transcription initiation, preinitiation complex, RNA polymerase II, transcription bubble; 2.90A {Sulfolobus solfataricus} SCOP: a.4.5.41 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A* Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2y75_A HTH-type transcriptional regulator CYMR; DNA binding protein; 2.00A {Bacillus subtilis} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>4fd7_A Putative arylalkylamine N-acetyltransferase 7; GNAT, COA binding; 1.80A {Aedes aegypti} Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1vhs_A Similar to phosphinothricin acetyltransferase; structural genomics, unknown function; 1.80A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1r1u_A CZRA, repressor protein; zinc, DNA binding, transcriptional regulation, winged HTH protein, transcription repressor; 2.00A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 1r1v_A 2kjb_A 2kjc_A Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>3cuo_A Uncharacterized HTH-type transcriptional regulato; DNA-binding transcriptional regulator, structural genomics, MCSG; 2.00A {Escherichia coli K12} Back     alignment and structure
>3pzj_A Probable acetyltransferases; MCSG, PSI-2, structural genomics, protein structure initiati midwest center for structural genomics; HET: MSE; 1.85A {Chromobacterium violaceum} Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* Back     alignment and structure
>2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3mq0_A Transcriptional repressor of the blcabc operon; helix-turn-helix, GAF fold, transcription repressor; 1.79A {Agrobacterium tumefaciens} Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>3tcv_A GCN5-related N-acetyltransferase; GRAM negative coccobacillus, brucellosis, acyl CO-A, arylami transferase; 1.75A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hqx_A P100 CO-activator tudor domain; human P100 tudor domain, proteolytic fragment, PSI, structural genomics; 1.42A {Homo sapiens} SCOP: b.34.9.1 PDB: 2hqe_A 3omc_A* 3omg_A* 2o4x_A 2e6n_A 2o4x_B Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1y0u_A Arsenical resistance operon repressor, putative; structural genomics, protein structure initiative, PSI; HET: MSE; 1.60A {Archaeoglobus fulgidus} SCOP: a.4.5.5 Back     alignment and structure
>1oyi_A Double-stranded RNA-binding protein; (alpha+beta) helix-turn-helix, viral protein; NMR {Vaccinia virus} SCOP: a.4.5.19 Back     alignment and structure
>2jt1_A PEFI protein; solution structure, winged helix-turn-helix, transcripti regulatory protein, structural genomics, PSI-2; NMR {Salmonella typhimurium LT2} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kko_A Possible transcriptional regulatory protein (possibly ARSR-family); NESG, DNA-binding, transcription regulation, WHTH, homodimer; NMR {Mycobacterium bovis} PDB: 3gw2_A Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>1khc_A DNA cytosine-5 methyltransferase 3B2; five beta-sheets barrel followed by five-helix bundle; HET: DNA; 1.80A {Mus musculus} SCOP: b.34.9.2 PDB: 3flg_A* 3qkj_A* Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} Back     alignment and structure
>2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2qml_A BH2621 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: MSE; 1.55A {Bacillus halodurans} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>4fu6_A PC4 and SFRS1-interacting protein; structural genomics consortium, SGC, transcription; 2.10A {Homo sapiens} PDB: 2b8a_A 2nlu_A Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>3dlm_A Histone-lysine N-methyltransferase setdb1; setdb1_human, structural genomics, structural genomics consortium, SGC, alternative splicing; 1.77A {Homo sapiens} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>3pqk_A Biofilm growth-associated repressor; helix-turn-helix motif, winged-helix fold, transcriptional R DNA binding, transcription; 2.09A {Xylella fastidiosa} PDB: 3pqj_A Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>3r1k_A Enhanced intracellular surviVal protein; GNAT, acetyltransferase, transferase; HET: COA; 1.95A {Mycobacterium tuberculosis} PDB: 3sxo_A 3ryo_A 3uy5_A Back     alignment and structure
>2g7u_A Transcriptional regulator; ICLR family, structural genomics, PSI, protein structure initiative, midwest center for struc genomics; 2.30A {Rhodococcus SP} Back     alignment and structure
>1mkm_A ICLR transcriptional regulator; structural genomics, winged helix-turn-helix, PSI, protein structure initiative; 2.20A {Thermotoga maritima} SCOP: a.4.5.33 d.110.2.2 Back     alignment and structure
>3qby_A Hepatoma-derived growth factor-related protein 2; HDGF2, structural genomics consortium, SGC, protein binding; HET: M3L; 1.95A {Homo sapiens} SCOP: b.34.9.2 PDB: 3qj6_A* 3eae_A 1n27_A Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2oqg_A Possible transcriptional regulator, ARSR family P; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 1.54A {Rhodococcus SP} Back     alignment and structure
>2jlm_A Putative phosphinothricin N-acetyltransferase; methionine sulfoximine; 2.35A {Acinetobacter baylyi} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1u2w_A CADC repressor, cadmium efflux system accessory protein; LEAD, SOFT metal ION resistance, ARSR/SM family, DNA binding protein; 1.90A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 3f72_A Back     alignment and structure
>3ntk_A Maternal protein tudor; tudor domain, OB-fold, GERM cell formation, transcription; 1.80A {Drosophila melanogaster} PDB: 3nth_A* 3nti_A* Back     alignment and structure
>2xrn_A HTH-type transcriptional regulator TTGV; DNA-binding protein, tetramer gene regulator, cooperative DN binding, multidrug binding protein; 2.90A {Pseudomonas putida} PDB: 2xro_A Back     alignment and structure
>3r4k_A Transcriptional regulator, ICLR family; DNA/RNA-binding 3-helical bundle, profilin-like, structural joint center for structural genomics, JCSG; 2.46A {Ruegeria SP} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3te4_A GH12636P, dopamine N acetyltransferase, isoform A; dopamine/acetyl COA, N-acetyltransferase domain; HET: ACO; 1.46A {Drosophila melanogaster} PDB: 3v8i_A* Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2fck_A Ribosomal-protein-serine acetyltransferase, putat; ribosomal-protein structural genomics, PSI, protein structure initiative; HET: MSE; 1.70A {Vibrio cholerae o1 biovar eltor} SCOP: d.108.1.1 Back     alignment and structure
>3f6o_A Probable transcriptional regulator, ARSR family protein; transcriptional regulator,RHA00566,MCSG, structural genomics, PSI-2; 1.90A {Rhodococcus SP} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>4b9w_A TDRD1, tudor domain-containing protein 1; replication; HET: 2MR; 2.10A {Mus musculus} Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>3llr_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase, methylysine binding, STR genomics consortium, SGC, alternative promoter usage; HET: DNA BTB; 2.30A {Homo sapiens} SCOP: b.34.9.0 Back     alignment and structure
>2daq_A WHSC1L1 protein, isoform long; PWWP domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.34.9.2 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1sqh_A Hypothetical protein CG14615-PA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Drosophila melanogaster} SCOP: d.108.1.5 Back     alignment and structure
>1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2hv2_A Hypothetical protein; PSI, protein structure initiative, midwest center for struct genomics, MCSG, structural genomics, unknown function; HET: EPE PG4; 2.40A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>2ia2_A Putative transcriptional regulator; SAD, PSI-2, structural genomics, structure initiative, midwest center for structural genomic transcription; 2.10A {Rhodococcus SP} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1qbj_A Protein (double-stranded RNA specific adenosine D (ADAR1)); protein-Z-DNA complex, hydrolase-DNA complex; HET: DNA; 2.10A {Homo sapiens} SCOP: a.4.5.19 PDB: 3f21_A* 3f22_A* 3f23_A* 3irr_A* 3irq_D* 2gxb_A 2acj_A 2l54_A Back     alignment and structure
>1r1t_A Transcriptional repressor SMTB; zinc, transcriptional regulation, winged HTH protein, DNA binding, transcription repressor; 1.70A {Synechococcus elongatus pcc 7942} SCOP: a.4.5.5 PDB: 1r23_A 1smt_A 1r22_A Back     alignment and structure
>2lkp_A Transcriptional regulator, ARSR family; symmetric homodimer, NI(II) binding protein, DNA binding Pro transcription regulator; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>3h4q_A Putative acetyltransferase; NP_371943.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE P33; 2.50A {Staphylococcus aureus subsp} Back     alignment and structure
>3n7z_A Acetyltransferase, GNAT family; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.75A {Bacillus anthracis} Back     alignment and structure
>2xdp_A Lysine-specific demethylase 4C; oxidoreductase, histone modification; 1.56A {Homo sapiens} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1ub9_A Hypothetical protein PH1061; helix-turn-helix motif, winged helix motif, structural genom transcription; 2.05A {Pyrococcus horikoshii} SCOP: a.4.5.28 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3g3s_A GCN5-related N-acetyltransferase; ZP_00874857.1, acetyltransferase (GNAT) family, structural joint center for structural genomics, JCSG; HET: MSE; 1.80A {Streptococcus suis} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1oz2_A Lethal(3)malignant brain tumor-like protein; propeller, transcription repressor, three malignant brain TU repeats, transcription; HET: MES; 1.55A {Homo sapiens} SCOP: b.34.9.3 b.34.9.3 b.34.9.3 PDB: 1oyx_A* 1oz3_A* 3oq5_A* 2rhi_A* 2rhx_A* 2rjd_A 2rjc_A 2rje_A* 2rjf_A* 3uwn_A* 2pqw_A* 3p8h_A* 2rhu_A* 2rhy_A* 2rhz_A* 2ri3_A* 2ri2_A* 2ri5_A* Back     alignment and structure
>4b9x_A TDRD1, tudor domain-containing protein 1; replication; 2.80A {Mus musculus} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1oz2_A Lethal(3)malignant brain tumor-like protein; propeller, transcription repressor, three malignant brain TU repeats, transcription; HET: MES; 1.55A {Homo sapiens} SCOP: b.34.9.3 b.34.9.3 b.34.9.3 PDB: 1oyx_A* 1oz3_A* 3oq5_A* 2rhi_A* 2rhx_A* 2rjd_A 2rjc_A 2rje_A* 2rjf_A* 3uwn_A* 2pqw_A* 3p8h_A* 2rhu_A* 2rhy_A* 2rhz_A* 2ri3_A* 2ri2_A* 2ri5_A* Back     alignment and structure
>2d1h_A ST1889, 109AA long hypothetical transcriptional regulator; helix-turn-helix, intermolecular and intramolecular S-S bond structural genomics; 2.05A {Sulfolobus tokodaii} SCOP: a.4.5.50 Back     alignment and structure
>3f2g_A Alkylmercury lyase; MERB, organomercurial lyase, mercury resistance, mercuric resistance, plasmid; 1.78A {Escherichia coli} PDB: 3f2h_A 3fn8_A 1s6l_A 3f0o_A 3f0p_A 3f2f_A Back     alignment and structure
>2ozg_A GCN5-related N-acetyltransferase; YP_325469.1, acetyltransfe (GNAT) family, structural genomics, joint center for struct genomics, JCSG; HET: COA; 2.00A {Anabaena variabilis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2biv_A SCML2 protein, sex COMB on midleg-like protein 2; MBT, malignant brain tumor, transcription factor; 1.7A {Homo sapiens} SCOP: b.34.9.3 b.34.9.3 PDB: 1oi1_A 2vyt_A* 2p0k_A Back     alignment and structure
>2vzy_A RV0802C; transferase, GCN5-related N-acetyltransferase, succinyltransferase; HET: FLC; 2.00A {Mycobacterium tuberculosis} PDB: 2vzz_A* Back     alignment and structure
>1yk3_A Hypothetical protein RV1347C/MT1389; acyltransferase, GCN5-related fold, structural genomics, PSI, protein structure initiative; HET: BOG; 2.20A {Mycobacterium tuberculosis} SCOP: d.108.1.1 Back     alignment and structure
>2o0y_A Transcriptional regulator; ICLR-family, structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.00A {Rhodococcus SP} Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2g0b_A FEEM; N-acyl transferase, environmental DNA, protein-product compl antibiotic synthase, transferase; HET: NLT; 3.00A {Uncultured bacterium} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1pfb_A Polycomb protein; chromatin, histone methylation, polycomb, chromodomain, peptide binding protein; HET: M3L; 1.40A {Drosophila melanogaster} SCOP: b.34.13.2 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>3i91_A Chromobox protein homolog 8; chromobox homolog 8, CBX8, structural genomics structural genomics consortium, SGC, chromatin regulator, N phosphoprotein, repressor; HET: M3L; 1.55A {Homo sapiens} SCOP: b.34.13.2 PDB: 3gv6_A* 3i90_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 449
d1fy7a_273 d.108.1.1 (A:) Histone acetyltransferase ESA1 {Bak 1e-153
d2giva1271 d.108.1.1 (A:4-274) Probable histone acetyltransfe 1e-151
d2ozua1270 d.108.1.1 (A:507-776) Histone acetyltransferase MY 1e-144
d1wgsa_133 b.34.13.3 (A:) Probable histone acetyltransferase 1e-28
d1boba_315 d.108.1.1 (A:) Histone acetyltransferase HAT1 {Bak 6e-23
d2buda188 b.34.13.3 (A:367-454) Putative histone acetyltrans 4e-16
d1m36a_33 g.37.1.2 (A:) Monocytic leukemia zinc finger prote 4e-09
d2f5ka183 b.34.13.3 (A:6-88) Mortality factor 4-like protein 2e-05
>d1fy7a_ d.108.1.1 (A:) Histone acetyltransferase ESA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 273 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Acyl-CoA N-acyltransferases (Nat)
superfamily: Acyl-CoA N-acyltransferases (Nat)
family: N-acetyl transferase, NAT
domain: Histone acetyltransferase ESA1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score =  433 bits (1115), Expect = e-153
 Identities = 146/271 (53%), Positives = 198/271 (73%)

Query: 174 KVKNIATIELGRYEIETWYFSPFPPEYNDCLKLYFCEFCLNFMKRKEQLQRHMRKCDLKH 233
           +V+N+  I +G+YEIE WYFSP+P E  D   +Y  +F L +   K+Q +R+ +KC L+H
Sbjct: 2   RVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRH 61

Query: 234 PPGDEIYRSGTLSMFEVDGKKNKVYGQNLCYLAKLFLDHKTLYYDVDLFLFYVLCECDDR 293
           PPG+EIYR   +S FE+DG+K + + +NLC L+KLFLDHKTLYYDVD FLFY +   D+ 
Sbjct: 62  PPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTRRDEL 121

Query: 294 GCHMVGYFSKEKHSEESYNLACILTLPPYQRKGYGKFLIAFSYELSKKEGKVGTPERPLS 353
           G H+VGYFSKEK S + YN+ACILTLP YQR GYGK LI FSYELSKKE KVG+PE+PLS
Sbjct: 122 GHHLVGYFSKEKESADGYNVACILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPEKPLS 181

Query: 354 DLGLLSYRGYWTRVLLDILKKHKGNISIKELSDMTAIKAEDILTTLQSLELIQYRKGQHV 413
           DLGLLSYR YW+  L+ +L +H+  I+I E+S MT++   DIL T ++L +++Y KGQH+
Sbjct: 182 DLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHI 241

Query: 414 ICADPKVLDRHLKAAGRGGLEVDVSKLIWTP 444
           I  +  +LDR+ +   +    +D ++LIW P
Sbjct: 242 IFLNEDILDRYNRLKAKKRRTIDPNRLIWKP 272
>d2giva1 d.108.1.1 (A:4-274) Probable histone acetyltransferase MYST1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d2ozua1 d.108.1.1 (A:507-776) Histone acetyltransferase MYST3 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1wgsa_ b.34.13.3 (A:) Probable histone acetyltransferase MYST1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 133 Back     information, alignment and structure
>d1boba_ d.108.1.1 (A:) Histone acetyltransferase HAT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 315 Back     information, alignment and structure
>d2buda1 b.34.13.3 (A:367-454) Putative histone acetyltransferase MOF {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1m36a_ g.37.1.2 (A:) Monocytic leukemia zinc finger protein Moz {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d2f5ka1 b.34.13.3 (A:6-88) Mortality factor 4-like protein 1, MRG15 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query449
d1fy7a_273 Histone acetyltransferase ESA1 {Baker's yeast (Sac 100.0
d2giva1271 Probable histone acetyltransferase MYST1 {Human (H 100.0
d2ozua1270 Histone acetyltransferase MYST3 {Human (Homo sapie 100.0
d1wgsa_133 Probable histone acetyltransferase MYST1 {Mouse (M 99.84
d1boba_315 Histone acetyltransferase HAT1 {Baker's yeast (Sac 99.79
d2f5ka183 Mortality factor 4-like protein 1, MRG15 {Human (H 99.6
d2buda188 Putative histone acetyltransferase MOF {Fruit fly 99.55
d1m36a_33 Monocytic leukemia zinc finger protein Moz {Human 99.03
d2d9ta160 Tudor domain-containing protein 3, TDRD3 {Mouse (M 96.53
d1yvka1152 Hypothetical protein YvbK (BSu33890) {Bacillus sub 96.42
d2atra1137 Probable acetyltransferase SP0256 {Streptococcus p 96.28
d1mhna_59 Survival motor neuron protein 1, smn {Human (Homo 96.18
d2aj6a1118 Hypothetical protein MW0638 {Staphylococcus aureus 96.15
d1y9wa1140 Probable acetyltransferase BC2806 {Bacillus cereus 95.86
d1y9ka1152 IAA acetyltransferase {Bacillus cereus [TaxId: 139 95.78
d1y7ra1133 Hypothetical protein SA2161 {Staphylococcus aureus 95.75
d1n71a_180 Aminoglycoside 6'-N-acetyltransferase {Enterococcu 95.72
d1ufha_155 Putative acetyltransferase YycN {Bacillus subtilis 95.61
d2fiwa1156 Probable N-acetyltransferase RPA1999 {Rhodopseudom 95.59
d1mkma175 Transcriptional regulator IclR, N-terminal domain 95.22
d2fe7a1156 Probable N-acetyltransferase PA0478 {Pseudomonas a 95.21
d1tiqa_173 Protease synthase and sporulation negative regulat 95.18
d2jdca1145 Probable acetyltransferase YitI {Bacillus lichenif 95.04
d1bo4a_137 Aminoglycoside 3-N-acetyltransferase {Serratia mar 94.96
d2hqxa190 P100 co-activator, SND1 {Human (Homo sapiens) [Tax 94.94
d1xeba_149 Hypothetical protein PA0115 {Pseudomonas aeruginos 94.93
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 94.9
d1yvoa1169 Hypothetical protein PA4866 {Pseudomonas aeruginos 94.82
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 94.75
d1qsma_150 Histone acetyltransferase HPA2 {Baker's yeast (Sac 94.66
d2fl4a1146 Probable spermine/spermidine acetyltransferase EF1 94.66
d2gana1182 Hypothetical protein PH0736 {Pyrococcus horikoshii 94.65
d1qsra_162 Catalytic domain of GCN5 histone acetyltransferase 94.61
d1ygha_164 Catalytic domain of GCN5 histone acetyltransferase 94.55
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 94.48
d1vkca_149 Putative acetyltransferase PF0028 {Pyrococcus furi 94.32
d2fiaa1157 Probable acetyltransferase EF1919 {Enterococcus fa 94.27
d1wjqa_107 Lethal(3)malignant brain tumor-like 3 protein, L3M 94.26
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 94.26
d1wwza1157 Hypothetical protein PH1933 {Pyrococcus horikoshii 94.23
d1z4ea1150 Transcriptional regulator BH1968 {Bacillus halodur 94.21
d1r57a_102 Hypothetical protein SA2309 {Staphylococcus aureus 93.96
d2diqa197 Tudor and KH domain-containing protein TDRKH {Huma 93.88
d1yr0a1163 Phosphinothricin acetyltransferase {Agrobacterium 93.85
d2nlua1100 Hepatoma-derived growth factor, HDGF {Human (Homo 93.73
d1j5ya165 Putative transcriptional regulator TM1602, N-termi 93.71
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 93.69
d1ghea_170 Tabtoxin resistance protein {Pseudomonas syringae 93.64
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 93.48
d1yx0a1151 Hypothetical protein YsnE {Bacillus subtilis [TaxI 93.48
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 93.27
d1q2ya_140 Probable acetyltransferase YjcF {Bacillus subtilis 93.04
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 92.95
d1oz2a2108 Lethal(3)malignant brain tumor-like protein {Human 92.8
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 92.77
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 92.72
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 92.67
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 92.62
d1z4ra1162 Catalytic domain of GCN5 histone acetyltransferase 92.61
d1p0ha_308 Mycothiol synthase MshD {Mycobacterium tuberculosi 92.53
d2g3aa1137 Probable acetyltransferase Atu2258 {Agrobacterium 92.5
d2cota238 Zinc finger and SCAN domain-containing protein 16, 92.4
d1vhsa_165 Putative phosphinothricin acetyltransferase YwnH { 92.3
d1u6ma_189 Putative acetyltransferase EF0945 {Enterococcus fa 92.29
d1cjwa_166 Serotonin N-acetyltranferase {Sheep (Ovis aries) [ 92.07
d1oz2a3106 Lethal(3)malignant brain tumor-like protein {Human 91.78
d2ae6a1161 Putative acetyltransferase EF0244 {Enterococcus fa 91.76
d1s3za_147 Aminoglycoside N-acetyltransferase AAC(6')-IY {Sal 91.73
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 91.72
d1i12a_157 Glucosamine-phosphate N-acetyltransferase GNA1 {Ba 91.52
d2i6ca1160 Putative acetyltransferase PA4794 {Pseudomonas aer 91.51
d2daqa197 Histone-lysine N-methyltransferase NSD3 {Human (Ho 91.37
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 91.28
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 91.2
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 91.12
d2qqra159 Jumonji domain-containing protein 2A {Human (Homo 91.0
d2ge3a1164 Probable acetyltransferase Atu2290 {Agrobacterium 90.92
d1h3za_108 Hypothetical protein SPBC215.07c {Fission yeast (S 90.78
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 90.55
d1oi1a2104 Scml2 protein {Human (Homo sapiens) [TaxId: 9606]} 90.35
d2beia1167 Diamine acetyltransferase 2 {Human (Homo sapiens) 90.16
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 90.07
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 89.48
d1oi1a1103 Scml2 protein {Human (Homo sapiens) [TaxId: 9606]} 89.26
d1oz2a1110 Lethal(3)malignant brain tumor-like protein {Human 88.86
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 88.79
d1wjsa_127 Lethal(3)malignant brain tumor-like 3 protein, L3M 88.79
d2ozga2283 Putative acetyltransferase Ava4977 {Anabaena varia 88.57
d1khca_137 DNA methyltransferase DNMT3B {Mouse (Mus musculus) 88.49
d1mk4a_157 Hypothetical protein YqiY {Bacillus subtilis [TaxI 88.26
d1pfba_55 Polycomb protein, Pc {Fruit fly (Drosophila melano 88.02
d1q3la_52 Heterochromatin protein 1, HP1 {Fruit fly (Drosoph 87.5
d2dnva152 Chromobox protein homolog 8 {Mouse (Mus musculus) 87.04
d1m4ia_181 Aminoglycoside 2'-N-acetyltransferase {Mycobacteri 86.65
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 86.41
d2dnta166 Chromodomain protein, Y-like isoform {Human (Homo 86.29
d1z05a171 Transcriptional regulator VC2007 N-terminal domain 86.06
d2hv2a2285 Hypothetical protein EF1021 {Enterococcus faecalis 85.89
d2d1ha1109 Hypothetical transcriptional regulator ST1889 {Sul 85.81
d2diga155 Lamin-b receptor {Human (Homo sapiens) [TaxId: 960 85.61
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 85.6
d1jhfa171 LexA repressor, N-terminal DNA-binding domain {Esc 85.55
d2cy2a1174 Probable acetyltransferase TTHA1209 {Thermus therm 85.29
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 85.0
d2fbha1137 Transcriptional regulator PA3341 {Pseudomonas aeru 84.94
d1l0oc_57 SigmaF {Bacillus stearothermophilus [TaxId: 1422]} 84.48
d1nsla_180 Probable acetyltransferase YdaF {Bacillus subtilis 83.97
d1ub9a_100 Hypothetical protein PH1061 {Archaeon Pyrococcus h 83.81
d2b5ga1167 Diamine acetyltransferase 1 {Human (Homo sapiens) 83.61
d2qqra256 Jumonji domain-containing protein 2A {Human (Homo 83.29
d1sqha_297 Hypothetical protein cg14615-pa {Fruit fly (Drosop 81.83
d1z6ra170 Mlc protein N-terminal domain {Escherichia coli [T 81.33
d1i1ga160 LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} 81.17
d1ku9a_151 DNA-binding protein Mj223 {Archaeon Methanococcus 80.76
d1p0ha_308 Mycothiol synthase MshD {Mycobacterium tuberculosi 80.34
d2cyya160 Putative transcriptional regulator PH1519 {Archaeo 80.16
>d1fy7a_ d.108.1.1 (A:) Histone acetyltransferase ESA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Acyl-CoA N-acyltransferases (Nat)
superfamily: Acyl-CoA N-acyltransferases (Nat)
family: N-acetyl transferase, NAT
domain: Histone acetyltransferase ESA1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=100.00  E-value=7.7e-122  Score=894.47  Aligned_cols=273  Identities=53%  Similarity=1.005  Sum_probs=269.0

Q ss_pred             cccCCccEEEecceeeecccCCCCCcCcCCCCcEEEeccccccccCHHHHHHHHhhCCCCCCCccEEEecCCeEEEEEeC
Q 013121          173 TKVKNIATIELGRYEIETWYFSPFPPEYNDCLKLYFCEFCLNFMKRKEQLQRHMRKCDLKHPPGDEIYRSGTLSMFEVDG  252 (449)
Q Consensus       173 t~~rni~~I~~G~y~i~tWY~SPYP~e~~~~~~lyiCe~Cl~y~~~~~~l~~H~~~C~~~~PPG~eIYr~~~isifEVDG  252 (449)
                      +|||||++|+||+|+|+||||||||++|.+.++||||||||+||+++++|.+|+.+|..+||||+||||++++|||||||
T Consensus         1 ~kirnI~~i~~G~y~~~tWY~SPyp~~~~~~~~lyvCe~Clky~~~~~~~~~H~~~C~~r~PPG~eIYr~~~~svfEVdG   80 (273)
T d1fy7a_           1 ARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDG   80 (273)
T ss_dssp             CCCCCCCEEEETTEEECCSSCCCCCCCCCSCCEEEECTTTCCEESSHHHHHHHHTSCCCSSCSSEEEEECSSEEEEEEEG
T ss_pred             CCccccceEEECCeeEcCCcCCCCchhhcCCCeEEEccccCCccCCHHHHHHHHHhCcccCCCCceEEecCCeEEEEecC
Confidence            47999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCcchhhhhhHHhhhhcccccceecCCCceEEEEEEecCCCceeeeeecccccCCCCceeeEEeecCcccccccchhhh
Q 013121          253 KKNKVYGQNLCYLAKLFLDHKTLYYDVDLFLFYVLCECDDRGCHMVGYFSKEKHSEESYNLACILTLPPYQRKGYGKFLI  332 (449)
Q Consensus       253 ~~~k~yCQnLCLlaKLFLdhKTlyyDV~~FlFYVl~e~d~~g~h~vGYFSKEK~s~~~~NLaCIl~lP~yQrkGyG~~LI  332 (449)
                      +++++|||||||||||||||||||||||+|+|||||+.|+.|+|+||||||||.|+++||||||||||||||||||+|||
T Consensus        81 ~~~~~yCqnLcLlaKLFLd~Ktl~yDv~~F~FYvl~~~D~~g~h~vGyFSKEk~s~~~nNLaCIltLP~~QrkGyG~~LI  160 (273)
T d1fy7a_          81 RKQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVACILTLPQYQRMGYGKLLI  160 (273)
T ss_dssp             GGSHHHHHHHHHHHHTTCSCCSCTTCCTTEEEEEEEEEETTEEEEEEEEEEESSCTTCEEESCEEECGGGCSSSHHHHHH
T ss_pred             ccchhHHHHHHHHHHhhcccccccccCCceEEEEEeeecCCCceeeeecceeccccCCceeEEEEecChHHhcchhhhHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhchhhhhccCCCCCCCccCChhhhhHHHhhhHHHHHHHHHhCCCCccHHHHHHhcCCChHHHHHHHHhcCceeeeCCeE
Q 013121          333 AFSYELSKKEGKVGTPERPLSDLGLLSYRGYWTRVLLDILKKHKGNISIKELSDMTAIKAEDILTTLQSLELIQYRKGQH  412 (449)
Q Consensus       333 ~fSYeLSr~E~~~G~PErPLSDLG~~sY~sYW~~~il~~L~~~~~~isi~~is~~Tgi~~~DIi~tL~~l~ll~~~~g~~  412 (449)
                      +|||+|||+||++|||||||||||+++|++||+++|+++|.+++++|||+|||++|||+++||++||++||||++++|+|
T Consensus       161 ~fSYeLSr~E~~~G~PEkPLSdlG~~sY~~YW~~~i~~~l~~~~~~isi~~is~~T~i~~~Dii~tL~~l~~l~~~~g~~  240 (273)
T d1fy7a_         161 EFSYELSKKENKVGSPEKPLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQH  240 (273)
T ss_dssp             HHHHHHHHHTTCCBEECSSCCHHHHHHHHHHHHHHHHHHHHHTCSEEEHHHHHHHHCBCHHHHHHHHHHHTCEEEETTEE
T ss_pred             HHHHHHhhhcccCCCCCCCCCHHHHHHHHHHHHHHHHHHHHhCCCCccHHHHHHhcCCCHHHHHHHHHHCCCEEEECCeE
Confidence            99999999999999999999999999999999999999999998999999999999999999999999999999999999


Q ss_pred             EEEeCHHHHHHHHHHhcCCCceeeCCCceEecC
Q 013121          413 VICADPKVLDRHLKAAGRGGLEVDVSKLIWTPY  445 (449)
Q Consensus       413 ~i~~~~~~i~~~~~~~~~~~~~id~~~L~W~P~  445 (449)
                      +|+++.++++++.+...++++.|||++|+|+|+
T Consensus       241 ~i~~~~~~~~~~~~~~~k~~~~idp~~L~W~Pp  273 (273)
T d1fy7a_         241 IIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPP  273 (273)
T ss_dssp             EEECCHHHHHHHHHHHHTCCCCCCGGGBCCCCC
T ss_pred             EEEeCHHHHHHHHHHhcCCCceechHHceeCCC
Confidence            999999999999888788889999999999995
>d2giva1 d.108.1.1 (A:4-274) Probable histone acetyltransferase MYST1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozua1 d.108.1.1 (A:507-776) Histone acetyltransferase MYST3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgsa_ b.34.13.3 (A:) Probable histone acetyltransferase MYST1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1boba_ d.108.1.1 (A:) Histone acetyltransferase HAT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f5ka1 b.34.13.3 (A:6-88) Mortality factor 4-like protein 1, MRG15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2buda1 b.34.13.3 (A:367-454) Putative histone acetyltransferase MOF {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m36a_ g.37.1.2 (A:) Monocytic leukemia zinc finger protein Moz {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d9ta1 b.34.9.1 (A:8-67) Tudor domain-containing protein 3, TDRD3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yvka1 d.108.1.1 (A:5-156) Hypothetical protein YvbK (BSu33890) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2atra1 d.108.1.1 (A:1-137) Probable acetyltransferase SP0256 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1mhna_ b.34.9.1 (A:) Survival motor neuron protein 1, smn {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2aj6a1 d.108.1.1 (A:1-118) Hypothetical protein MW0638 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1y9wa1 d.108.1.1 (A:1-140) Probable acetyltransferase BC2806 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1y9ka1 d.108.1.1 (A:1-152) IAA acetyltransferase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1y7ra1 d.108.1.1 (A:1-133) Hypothetical protein SA2161 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1n71a_ d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]} Back     information, alignment and structure
>d1ufha_ d.108.1.1 (A:) Putative acetyltransferase YycN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fiwa1 d.108.1.1 (A:2-157) Probable N-acetyltransferase RPA1999 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d1mkma1 a.4.5.33 (A:1-75) Transcriptional regulator IclR, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fe7a1 d.108.1.1 (A:3-158) Probable N-acetyltransferase PA0478 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1tiqa_ d.108.1.1 (A:) Protease synthase and sporulation negative regulatory protein PaiA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2jdca1 d.108.1.1 (A:2-146) Probable acetyltransferase YitI {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure
>d1bo4a_ d.108.1.1 (A:) Aminoglycoside 3-N-acetyltransferase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d2hqxa1 b.34.9.1 (A:8-97) P100 co-activator, SND1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xeba_ d.108.1.1 (A:) Hypothetical protein PA0115 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yvoa1 d.108.1.1 (A:4-172) Hypothetical protein PA4866 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qsma_ d.108.1.1 (A:) Histone acetyltransferase HPA2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fl4a1 d.108.1.1 (A:1-146) Probable spermine/spermidine acetyltransferase EF1086 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2gana1 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1qsra_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]} Back     information, alignment and structure
>d1ygha_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vkca_ d.108.1.1 (A:) Putative acetyltransferase PF0028 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2fiaa1 d.108.1.1 (A:1-157) Probable acetyltransferase EF1919 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1wjqa_ b.34.9.3 (A:) Lethal(3)malignant brain tumor-like 3 protein, L3MBTL3 (KIAA1798) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwza1 d.108.1.1 (A:1-157) Hypothetical protein PH1933 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1z4ea1 d.108.1.1 (A:4-153) Transcriptional regulator BH1968 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1r57a_ d.108.1.1 (A:) Hypothetical protein SA2309 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2diqa1 b.34.9.1 (A:8-104) Tudor and KH domain-containing protein TDRKH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yr0a1 d.108.1.1 (A:4-166) Phosphinothricin acetyltransferase {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2nlua1 b.34.9.2 (A:1-100) Hepatoma-derived growth factor, HDGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j5ya1 a.4.5.1 (A:3-67) Putative transcriptional regulator TM1602, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1ghea_ d.108.1.1 (A:) Tabtoxin resistance protein {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yx0a1 d.108.1.1 (A:1-151) Hypothetical protein YsnE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q2ya_ d.108.1.1 (A:) Probable acetyltransferase YjcF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oz2a2 b.34.9.3 (A:314-421) Lethal(3)malignant brain tumor-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z4ra1 d.108.1.1 (A:497-658) Catalytic domain of GCN5 histone acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2g3aa1 d.108.1.1 (A:1-137) Probable acetyltransferase Atu2258 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vhsa_ d.108.1.1 (A:) Putative phosphinothricin acetyltransferase YwnH {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1u6ma_ d.108.1.1 (A:) Putative acetyltransferase EF0945 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1cjwa_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1oz2a3 b.34.9.3 (A:422-527) Lethal(3)malignant brain tumor-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ae6a1 d.108.1.1 (A:1-161) Putative acetyltransferase EF0244 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1s3za_ d.108.1.1 (A:) Aminoglycoside N-acetyltransferase AAC(6')-IY {Salmonella enteritidis [TaxId: 149539]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i12a_ d.108.1.1 (A:) Glucosamine-phosphate N-acetyltransferase GNA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2i6ca1 d.108.1.1 (A:1001-1160) Putative acetyltransferase PA4794 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2daqa1 b.34.9.2 (A:8-104) Histone-lysine N-methyltransferase NSD3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qqra1 b.34.9.1 (A:897-955) Jumonji domain-containing protein 2A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ge3a1 d.108.1.1 (A:6-169) Probable acetyltransferase Atu2290 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1h3za_ b.34.9.2 (A:) Hypothetical protein SPBC215.07c {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oi1a2 b.34.9.3 (A:140-243) Scml2 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2beia1 d.108.1.1 (A:3-169) Diamine acetyltransferase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oi1a1 b.34.9.3 (A:33-135) Scml2 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oz2a1 b.34.9.3 (A:204-313) Lethal(3)malignant brain tumor-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1wjsa_ b.34.9.3 (A:) Lethal(3)malignant brain tumor-like 3 protein, L3MBTL3 (KIAA1798) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozga2 d.108.1.10 (A:8-290) Putative acetyltransferase Ava4977 {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d1khca_ b.34.9.2 (A:) DNA methyltransferase DNMT3B {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mk4a_ d.108.1.1 (A:) Hypothetical protein YqiY {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1pfba_ b.34.13.2 (A:) Polycomb protein, Pc {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1q3la_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2dnva1 b.34.13.2 (A:7-58) Chromobox protein homolog 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m4ia_ d.108.1.1 (A:) Aminoglycoside 2'-N-acetyltransferase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dnta1 b.34.13.2 (A:8-73) Chromodomain protein, Y-like isoform {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z05a1 a.4.5.63 (A:10-80) Transcriptional regulator VC2007 N-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2hv2a2 d.108.1.10 (A:2-286) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2d1ha1 a.4.5.50 (A:1-109) Hypothetical transcriptional regulator ST1889 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2diga1 b.34.9.1 (A:8-62) Lamin-b receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jhfa1 a.4.5.2 (A:2-72) LexA repressor, N-terminal DNA-binding domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cy2a1 d.108.1.1 (A:1-174) Probable acetyltransferase TTHA1209 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbha1 a.4.5.28 (A:8-144) Transcriptional regulator PA3341 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1l0oc_ a.4.13.2 (C:) SigmaF {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1nsla_ d.108.1.1 (A:) Probable acetyltransferase YdaF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ub9a_ a.4.5.28 (A:) Hypothetical protein PH1061 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2b5ga1 d.108.1.1 (A:3-169) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qqra2 b.34.9.1 (A:956-1011) Jumonji domain-containing protein 2A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sqha_ d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1z6ra1 a.4.5.63 (A:12-81) Mlc protein N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i1ga1 a.4.5.32 (A:2-61) LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ku9a_ a.4.5.36 (A:) DNA-binding protein Mj223 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2cyya1 a.4.5.32 (A:5-64) Putative transcriptional regulator PH1519 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure