Citrus Sinensis ID: 013150

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------45

MASVSSQPQFRYTQPPSKVLHLRNLPWECTEEELIELGKPFGKVVNTKCNVGANRNQAFIEFADLNQAIAMISYYASSSEPAQVRGKTVYLQYSNRQEIVNNKTTADVAGNVLLVTIEGTDARLVSIDVLHLVFSAFGFVHKITTFEKTAGFQALVQFSDTETASSAKNALDGRSIPRYLLPENMGPCTLRITYSAHTDLSVKFQSHRSRDYTNPYLPVAPSAIDASGQLSVGLDGKKLEPESNVLLASIENMQYAVTLDVLHMVFSAFGPVQKIAMFDKNGGLQALIQYPDVQTAVVAKEALEGHCIYDGGFCKLHISYSRHTDLSIKVNNDRSRDYTLPSTPMVNSQPSILGQQPVPMVGATANQYNGAQFAPPPPEQPMMHQPTAAGWGAVPPASQSMPMMGNHPYMPPGSMPMGPGMMQMHMPGQSGMQHHHGAMPPPRPDHMQ

ccccccccccccccccccEEEcccccccccHHHHHHHccccccEEEEEEEEccccccEEEEcccHHHHHHHHHHHcccccccCEcccEEEEEEcccccccccccccccccEEEEEEEEccccccccHHHHHHHHcccccEEEEEEEcccccccEEEEcccHHHHHHHHHHcccccccccccccccccccEEEEccccccccECcccccccccccccccccccccccccccccccccccccccccEEEEEEccccccccHHHHHHHHcccccEEEEEEEEccccCEEEEEcccHHHHHHHHHHHccccccccccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

******************VLHLRNLPWECTEEELIELGKPFGKVVNTKCNVGANRNQAFIEFADLNQAIAMISYYASSSEPAQVRGKTVYLQYSNRQEIVNNKTTADVAGNVLLVTIEGTDARLVSIDVLHLVFSAFGFVHKITTFEKTAGFQALVQFSDTETASSAKNALDGRSIPRYLLPENMGPCTLRITYSAHTDLSVKFQSHR*RDYTNPYLPVA*******************EPESNVLLASIENMQYAVTLDVLHMVFSAFGPVQKIAMFDKNGGLQALIQYPDVQTAVVAKEALEGHCIYDGGFCKLHISYSRHTDLSIKV**********************************************************************************************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Polypyrimidine tract-binding protein homolog 2	Plays a role in pre-mRNA splicing. Binds to the polypyrimidine tract of introns. May promote the binding of U2 snRNP to pre-mRNA.	confident	Q9FGL9

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1SJR, chain A
Confidence level:very confident
Coverage over the Query: 240-347
View the alignment between query and template
View the model in PyMOL

Template: 1SJR, chain A
Confidence level:very confident
Coverage over the Query: 108-221
View the alignment between query and template
View the model in PyMOL

Template: 2GHP, chain A
Confidence level:very confident
Coverage over the Query: 18-95,112-198,240-324
View the alignment between query and template
View the model in PyMOL

Template: 1M2V, chain B
Confidence level:probable
Coverage over the Query: 383-396
View the alignment between query and template
View the model in PyMOL