BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 013153
         (448 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4FFB|C Chain C, A Tog:alphaBETA-Tubulin Complex Structure Reveals
           Conformation-Based Mechanisms For A Microtubule
           Polymerase
          Length = 278

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 41/102 (40%), Gaps = 31/102 (30%)

Query: 125 GRPDLGYLYWRWKPRLCKLPRFDPNAFLDFLRNKHLAFVGDSMARNQLESLLCMLSTVSV 184
            R D   +YWR           DP  F  ++ + ++  V    A   L SL+   ++ S+
Sbjct: 45  SRDDNIQIYWR-----------DPTLFAQYITDSNV--VAQEQAIVALNSLIDAFASSSL 91

Query: 185 PNLVYRDGEDNKFRRWHFDAHNVTVSVYWSPFLV-KGVEKSK 225
            N                 AHN+T+   W+P LV KG+  S+
Sbjct: 92  KN-----------------AHNITLISTWTPLLVEKGLTSSR 116


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.321    0.139    0.456 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 14,326,281
Number of Sequences: 62578
Number of extensions: 610952
Number of successful extensions: 1173
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 1173
Number of HSP's gapped (non-prelim): 3
length of query: 448
length of database: 14,973,337
effective HSP length: 102
effective length of query: 346
effective length of database: 8,590,381
effective search space: 2972271826
effective search space used: 2972271826
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 53 (25.0 bits)