Citrus Sinensis ID: 013182
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 448 | ||||||
| 255547492 | 453 | phosphatidylcholine-sterol O-acyltransfe | 0.995 | 0.984 | 0.747 | 0.0 | |
| 357507845 | 447 | Phospholipase A1 [Medicago truncatula] g | 0.968 | 0.970 | 0.732 | 0.0 | |
| 359476598 | 447 | PREDICTED: phospholipase A(1) LCAT3-like | 0.982 | 0.984 | 0.717 | 0.0 | |
| 356568525 | 443 | PREDICTED: phospholipase A(1) LCAT3-like | 0.973 | 0.984 | 0.719 | 0.0 | |
| 33318329 | 452 | phospholipase A1 [Nicotiana tabacum] | 0.941 | 0.933 | 0.739 | 0.0 | |
| 449442247 | 448 | PREDICTED: phospholipase A(1) LCAT3-like | 0.964 | 0.964 | 0.696 | 0.0 | |
| 18396510 | 447 | phospholipase A(1) LCAT3 [Arabidopsis th | 0.964 | 0.966 | 0.715 | 1e-180 | |
| 297832976 | 454 | lecithin:cholesterol acyltransferase fam | 0.964 | 0.951 | 0.711 | 1e-179 | |
| 242045288 | 463 | hypothetical protein SORBIDRAFT_02g02971 | 0.950 | 0.920 | 0.675 | 1e-171 | |
| 222618895 | 471 | hypothetical protein OsJ_02688 [Oryza sa | 0.937 | 0.891 | 0.672 | 1e-171 |
| >gi|255547492|ref|XP_002514803.1| phosphatidylcholine-sterol O-acyltransferase, putative [Ricinus communis] gi|223545854|gb|EEF47357.1| phosphatidylcholine-sterol O-acyltransferase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 717 bits (1852), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 337/451 (74%), Positives = 389/451 (86%), Gaps = 5/451 (1%)
Query: 1 MFGDCSFWPCFGDRQT---ESEVDPVLLVSGMGGSVLHAKRKKLGCE--TRVWVRILLAE 55
M GD PCFG+ T E + DPVLLVSG+GG +L++K+K LG E TRVWVRILLA+
Sbjct: 1 MLGDFCICPCFGNHNTDDTEPDRDPVLLVSGIGGCILNSKKKNLGFEFETRVWVRILLAD 60
Query: 56 LEFKRKVWSRYNPKTGYTESLDKDTEIVVPEDDYGLYAIDILDPSFILKLIHFTEVYHFH 115
EFK+K+WS YNPKTGYTE LD+ TE+VVP+DDYGLYAIDILDPS +K++H TE+YHFH
Sbjct: 61 YEFKKKIWSLYNPKTGYTEVLDESTELVVPDDDYGLYAIDILDPSLFVKVLHLTEIYHFH 120
Query: 116 DMIEMLVKCGYKKGTTLFGYGYDFRQSNRIDKLMEGLKVKLETAYKASGNRKVTLITHSM 175
DMI+MLVKCGYKKGTTLFGYGYDFRQSNRI K MEGLK KLETAY+ASG RKV +I+HSM
Sbjct: 121 DMIDMLVKCGYKKGTTLFGYGYDFRQSNRIGKSMEGLKAKLETAYEASGQRKVNIISHSM 180
Query: 176 GGLLVMCFMSLHKDVFSKFVNKWITIASPFQGAPGCINDSLLTGLQFVEGIASFFFVSRW 235
GGLLV+CFMSL+ DV SKFVNKWI+IA PFQGAPGCINDSLLTGLQFVEG S+FFVSRW
Sbjct: 181 GGLLVLCFMSLYTDVVSKFVNKWISIACPFQGAPGCINDSLLTGLQFVEGFESYFFVSRW 240
Query: 236 TMHQLLVECPSIYEMLANPDFKWKKQPQIKVWRKQSNDGESSAKLETYGPVESISLFKEA 295
TMHQLLVECPSIYEMLANPDFKW+ QPQI+VWRKQS+ E+S KLE+YGP +SI+LF+EA
Sbjct: 241 TMHQLLVECPSIYEMLANPDFKWESQPQIQVWRKQSDSDEASVKLESYGPQDSITLFQEA 300
Query: 296 LRNNELDYNGNSIALPFNFAILDWAAGTRQIINNAQLPNGVSYYNIYGTSYDTPFDVSYG 355
LRNNEL+Y+GN I+LPFNF IL WAAGTRQI+N+AQLP GVS+YNI+GTS DTPF+V YG
Sbjct: 301 LRNNELNYDGNKISLPFNFHILKWAAGTRQILNDAQLPKGVSFYNIFGTSNDTPFNVRYG 360
Query: 356 SETSPIEDLSEICHTMPKYSFVDGDGTVPAESAKADGFPAVERVGVPAEHRELLRDKTVF 415
+E SPIEDLSE+CHT+P+YS+VDGDGTVPAESAKADGF AVERVGV A HR LL DKTVF
Sbjct: 361 TEKSPIEDLSEVCHTLPQYSYVDGDGTVPAESAKADGFEAVERVGVAASHRGLLHDKTVF 420
Query: 416 ELIKKWLGVDQKMSKHSKSSRVADAPPNHHA 446
L++KWLGV Q+ +K S++SRV D H
Sbjct: 421 ALVRKWLGVAQEQTKLSRTSRVMDVSSVSHV 451
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|357507845|ref|XP_003624211.1| Phospholipase A1 [Medicago truncatula] gi|355499226|gb|AES80429.1| Phospholipase A1 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|359476598|ref|XP_002269879.2| PREDICTED: phospholipase A(1) LCAT3-like [Vitis vinifera] gi|297735233|emb|CBI17595.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356568525|ref|XP_003552461.1| PREDICTED: phospholipase A(1) LCAT3-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|33318329|gb|AAQ05032.1|AF468223_1 phospholipase A1 [Nicotiana tabacum] | Back alignment and taxonomy information |
|---|
| >gi|449442247|ref|XP_004138893.1| PREDICTED: phospholipase A(1) LCAT3-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|18396510|ref|NP_566201.1| phospholipase A(1) LCAT3 [Arabidopsis thaliana] gi|75163108|sp|Q93V61.1|LCAT3_ARATH RecName: Full=Phospholipase A(1) LCAT3; AltName: Full=Lecithin-cholesterol acyltransferase-like 3 gi|33312308|gb|AAQ04051.1|AF421148_1 phospholipase A1 [Arabidopsis thaliana] gi|15809942|gb|AAL06898.1| AT3g03310/T21P5_27 [Arabidopsis thaliana] gi|15912273|gb|AAL08270.1| AT3g03310/T21P5_27 [Arabidopsis thaliana] gi|21360561|gb|AAM47477.1| AT3g03310/T21P5_27 [Arabidopsis thaliana] gi|332640407|gb|AEE73928.1| phospholipase A(1) LCAT3 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297832976|ref|XP_002884370.1| lecithin:cholesterol acyltransferase family protein [Arabidopsis lyrata subsp. lyrata] gi|297330210|gb|EFH60629.1| lecithin:cholesterol acyltransferase family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|242045288|ref|XP_002460515.1| hypothetical protein SORBIDRAFT_02g029710 [Sorghum bicolor] gi|241923892|gb|EER97036.1| hypothetical protein SORBIDRAFT_02g029710 [Sorghum bicolor] | Back alignment and taxonomy information |
|---|
| >gi|222618895|gb|EEE55027.1| hypothetical protein OsJ_02688 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 448 | ||||||
| TAIR|locus:2099609 | 447 | LCAT3 "AT3G03310" [Arabidopsis | 0.964 | 0.966 | 0.715 | 7.7e-174 | |
| TAIR|locus:2133975 | 535 | AT4G19860 "AT4G19860" [Arabido | 0.908 | 0.760 | 0.532 | 3.7e-119 | |
| WB|WBGene00010872 | 417 | M05B5.4 [Caenorhabditis elegan | 0.214 | 0.230 | 0.303 | 1.2e-11 | |
| UNIPROTKB|Q6XPZ3 | 408 | PLA2G15 "Group XV phospholipas | 0.386 | 0.424 | 0.265 | 5e-11 | |
| UNIPROTKB|Q8NCC3 | 412 | PLA2G15 "Group XV phospholipas | 0.294 | 0.320 | 0.268 | 6.6e-11 | |
| UNIPROTKB|Q8WMP9 | 407 | PLA2G15 "Group XV phospholipas | 0.395 | 0.434 | 0.270 | 9.8e-11 | |
| MGI|MGI:2178076 | 412 | Pla2g15 "phospholipase A2, gro | 0.301 | 0.327 | 0.264 | 1.2e-10 | |
| RGD|1302982 | 413 | Pla2g15 "phospholipase A2, gro | 0.294 | 0.319 | 0.262 | 5.1e-10 | |
| UNIPROTKB|E1C0B0 | 415 | PLA2G15 "Uncharacterized prote | 0.424 | 0.457 | 0.261 | 2.2e-09 | |
| TAIR|locus:2015924 | 432 | AT1G27480 "AT1G27480" [Arabido | 0.424 | 0.439 | 0.265 | 1.2e-08 |
| TAIR|locus:2099609 LCAT3 "AT3G03310" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1689 (599.6 bits), Expect = 7.7e-174, P = 7.7e-174
Identities = 315/440 (71%), Positives = 371/440 (84%)
Query: 9 PCFG--DRQTESEV---DPVLLVSGMGGSVLHAKRKKLGCETRVWVRILLAELEFKRKVW 63
PC+G D + EV DPVLLVSG+GGS+LH+K+K E RVWVRI LA L FK+ +W
Sbjct: 7 PCWGTNDDENAGEVADRDPVLLVSGIGGSILHSKKKNSKSEIRVWVRIFLANLAFKQSLW 66
Query: 64 SRYNPKTGYTESLDKDTEIVVPEDDYGLYAIDILDPSFILKLIHFTEVYHFHDMIEMLVK 123
S YNPKTGYTE LD + E++VP+DD+GLYAIDILDPS+ +KL H TEVYHFHDMIEMLV
Sbjct: 67 SLYNPKTGYTEPLDDNIEVLVPDDDHGLYAIDILDPSWFVKLCHLTEVYHFHDMIEMLVG 126
Query: 124 CGYKKGTTLFGYGYDFRQSNRIDKLMEGLKVKLETAYKASGNRKVTLITHSMGGLLVMCF 183
CGYKKGTTLFGYGYDFRQSNRID L+ GLK KLETAYK SG RKVT+I+HSMGGL+V CF
Sbjct: 127 CGYKKGTTLFGYGYDFRQSNRIDLLILGLKKKLETAYKRSGGRKVTIISHSMGGLMVSCF 186
Query: 184 MSLHKDVFSKFVNKWITIASPFQGAPGCINDSLLTGLQFVEGIASFFFVSRWTMHQLLVE 243
M LH + FSK+VNKWITIA+PFQGAPGCINDS+LTG+QFVEG+ SFFFVSRWTMHQLLVE
Sbjct: 187 MYLHPEAFSKYVNKWITIATPFQGAPGCINDSILTGVQFVEGLESFFFVSRWTMHQLLVE 246
Query: 244 CPSIYEMLANPDFKWKKQPQIKVWRKQS-NDGESSAKLETYGPVESISLFKEALRNNELD 302
CPSIYEM+ANPDFKWKKQP+I+VWRK+S ND ++S +LE++G +ESI LF +AL+NNEL
Sbjct: 247 CPSIYEMMANPDFKWKKQPEIRVWRKKSENDVDTSVELESFGLIESIDLFNDALKNNELS 306
Query: 303 YNGNSIALPFNFAILDWAAGTRQIINNAQLPNGVSYYNIYGTSYDTPFDVSYGSETSPIE 362
Y GN IALPFNFAILDWAA TR+I+N AQLP+GVS+YNIYG S +TPFDV YG+ETSPI+
Sbjct: 307 YGGNKIALPFNFAILDWAAKTREILNKAQLPDGVSFYNIYGVSLNTPFDVCYGTETSPID 366
Query: 363 DLSEICHTMPKYSFVDGDGTVPAESAKADGFPAVERVGVPAEHRELLRDKTVFELIKKWL 422
DLSEIC TMP+Y++VDGDGTVPAESA A F AV VGV HR LLRD+ VFELI++WL
Sbjct: 367 DLSEICQTMPEYTYVDGDGTVPAESAAAAQFKAVASVGVSGSHRGLLRDERVFELIQQWL 426
Query: 423 GVDQKMSK--HSKSSRVADA 440
GV+ K +K H ++ +V D+
Sbjct: 427 GVEPKKAKRKHLRTHKVVDS 446
|
|
| TAIR|locus:2133975 AT4G19860 "AT4G19860" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00010872 M05B5.4 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6XPZ3 PLA2G15 "Group XV phospholipase A2" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8NCC3 PLA2G15 "Group XV phospholipase A2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8WMP9 PLA2G15 "Group XV phospholipase A2" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2178076 Pla2g15 "phospholipase A2, group XV" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1302982 Pla2g15 "phospholipase A2, group XV" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C0B0 PLA2G15 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2015924 AT1G27480 "AT1G27480" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 448 | |||
| PLN02733 | 440 | PLN02733, PLN02733, phosphatidylcholine-sterol O-a | 0.0 | |
| pfam02450 | 377 | pfam02450, LACT, Lecithin:cholesterol acyltransfer | 6e-18 | |
| PLN02517 | 642 | PLN02517, PLN02517, phosphatidylcholine-sterol O-a | 1e-05 | |
| COG1075 | 336 | COG1075, LipA, Predicted acetyltransferases and hy | 2e-04 | |
| pfam05990 | 230 | pfam05990, DUF900, Alpha/beta hydrolase of unknown | 0.003 |
| >gnl|CDD|215390 PLN02733, PLN02733, phosphatidylcholine-sterol O-acyltransferase | Back alignment and domain information |
|---|
Score = 779 bits (2015), Expect = 0.0
Identities = 279/438 (63%), Positives = 342/438 (78%), Gaps = 7/438 (1%)
Query: 8 WPCFGDRQT---ESEVDPVLLVSGMGGSVLHAKRKKLGCETRVWVRILLAELEFKRKVWS 64
P Q + ++DPVLLV G+GGS+L+A K G E RVWVRI A+ EF++K+WS
Sbjct: 4 LPLIKKGQDPYVDPDLDPVLLVPGIGGSILNAVDKDGGNEERVWVRIFAADHEFRKKLWS 63
Query: 65 RYNPKTGYTESLDKDTEIVVPEDDYGLYAIDILDPSFILKLIHFTEVYHFHDMIEMLVKC 124
RY+PKTG T SLD TEIVVP+D YGLYAIDILDP I++L EVY+FHDMIE L+K
Sbjct: 64 RYDPKTGKTVSLDPKTEIVVPDDRYGLYAIDILDPDVIIRL---DEVYYFHDMIEQLIKW 120
Query: 125 GYKKGTTLFGYGYDFRQSNRIDKLMEGLKVKLETAYKASGNRKVTLITHSMGGLLVMCFM 184
GYK+G TLFG+GYDFRQSNR+ + M+GLK KLET YKASG +KV +I+HSMGGLLV CFM
Sbjct: 121 GYKEGKTLFGFGYDFRQSNRLPETMDGLKKKLETVYKASGGKKVNIISHSMGGLLVKCFM 180
Query: 185 SLHKDVFSKFVNKWITIASPFQGAPGCINDSLLTGLQFVEGIASFFFVSRWTMHQLLVEC 244
SLH DVF K+VN WI IA+PFQGAPG I DSLLTG+ FVEG S FFVS+W+MHQLL+EC
Sbjct: 181 SLHSDVFEKYVNSWIAIAAPFQGAPGFITDSLLTGVSFVEGWESEFFVSKWSMHQLLIEC 240
Query: 245 PSIYEMLANPDFKWKKQPQIKVWRKQS-NDGESSAKLETYGPVESISLFKEALRNNELDY 303
PSIYE++ANPDFKW++ P+++VWRK+S NDG SS LE+YGP+ESI +F++AL NN L+Y
Sbjct: 241 PSIYELMANPDFKWEEPPELQVWRKKSDNDGNSSVVLESYGPLESIEVFEDALSNNTLNY 300
Query: 304 NGNSIALPFNFAILDWAAGTRQIINNAQLPNGVSYYNIYGTSYDTPFDVSYGSETSPIED 363
+G I LPFNF IL WA TR+I+++A+LP GV +YNIYGTS DTPFDV YGSE SPIED
Sbjct: 301 DGEKIPLPFNFDILKWANETRRILSSAKLPKGVKFYNIYGTSLDTPFDVCYGSEKSPIED 360
Query: 364 LSEICHTMPKYSFVDGDGTVPAESAKADGFPAVERVGVPAEHRELLRDKTVFELIKKWLG 423
LSEI HT P+Y++VDGDGTVP ESAKADG AV RVGVP +HR +LRD+ VF ++K WL
Sbjct: 361 LSEILHTEPEYTYVDGDGTVPVESAKADGLNAVARVGVPGDHRGILRDEHVFRILKHWLK 420
Query: 424 VDQKMSKHSKSSRVADAP 441
V + ++ + P
Sbjct: 421 VGEPDPFYNPINDYVILP 438
|
Length = 440 |
| >gnl|CDD|217043 pfam02450, LACT, Lecithin:cholesterol acyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|178132 PLN02517, PLN02517, phosphatidylcholine-sterol O-acyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|224001 COG1075, LipA, Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|218844 pfam05990, DUF900, Alpha/beta hydrolase of unknown function (DUF900) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 448 | |||
| PLN02733 | 440 | phosphatidylcholine-sterol O-acyltransferase | 100.0 | |
| PLN02517 | 642 | phosphatidylcholine-sterol O-acyltransferase | 100.0 | |
| KOG2369 | 473 | consensus Lecithin:cholesterol acyltransferase (LC | 100.0 | |
| PF02450 | 389 | LCAT: Lecithin:cholesterol acyltransferase; InterP | 100.0 | |
| COG2267 | 298 | PldB Lysophospholipase [Lipid metabolism] | 99.18 | |
| PF06028 | 255 | DUF915: Alpha/beta hydrolase of unknown function ( | 99.16 | |
| PLN02965 | 255 | Probable pheophorbidase | 99.14 | |
| PRK10749 | 330 | lysophospholipase L2; Provisional | 99.11 | |
| PHA02857 | 276 | monoglyceride lipase; Provisional | 99.1 | |
| PLN02824 | 294 | hydrolase, alpha/beta fold family protein | 99.08 | |
| PRK00870 | 302 | haloalkane dehalogenase; Provisional | 99.05 | |
| PLN02298 | 330 | hydrolase, alpha/beta fold family protein | 99.01 | |
| PRK03592 | 295 | haloalkane dehalogenase; Provisional | 99.01 | |
| PLN02385 | 349 | hydrolase; alpha/beta fold family protein | 99.0 | |
| TIGR02240 | 276 | PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer | 98.96 | |
| PLN02211 | 273 | methyl indole-3-acetate methyltransferase | 98.96 | |
| PF12697 | 228 | Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 | 98.95 | |
| TIGR01607 | 332 | PST-A Plasmodium subtelomeric family (PST-A). Thes | 98.92 | |
| TIGR03101 | 266 | hydr2_PEP hydrolase, ortholog 2, exosortase system | 98.9 | |
| PF01674 | 219 | Lipase_2: Lipase (class 2); InterPro: IPR002918 Li | 98.88 | |
| PRK11126 | 242 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl | 98.84 | |
| PRK03204 | 286 | haloalkane dehalogenase; Provisional | 98.82 | |
| PLN02679 | 360 | hydrolase, alpha/beta fold family protein | 98.81 | |
| PRK08775 | 343 | homoserine O-acetyltransferase; Provisional | 98.81 | |
| PF07819 | 225 | PGAP1: PGAP1-like protein; InterPro: IPR012908 The | 98.8 | |
| PRK10349 | 256 | carboxylesterase BioH; Provisional | 98.79 | |
| PLN03084 | 383 | alpha/beta hydrolase fold protein; Provisional | 98.78 | |
| TIGR03056 | 278 | bchO_mg_che_rel putative magnesium chelatase acces | 98.78 | |
| KOG4178 | 322 | consensus Soluble epoxide hydrolase [Lipid transpo | 98.77 | |
| TIGR01836 | 350 | PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth | 98.75 | |
| TIGR03695 | 251 | menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene | 98.74 | |
| PRK10673 | 255 | acyl-CoA esterase; Provisional | 98.72 | |
| TIGR03100 | 274 | hydr1_PEP hydrolase, ortholog 1, exosortase system | 98.72 | |
| PLN02578 | 354 | hydrolase | 98.72 | |
| TIGR03343 | 282 | biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die | 98.71 | |
| TIGR02427 | 251 | protocat_pcaD 3-oxoadipate enol-lactonase. Members | 98.69 | |
| KOG1455 | 313 | consensus Lysophospholipase [Lipid transport and m | 98.69 | |
| PLN02652 | 395 | hydrolase; alpha/beta fold family protein | 98.68 | |
| PF00561 | 230 | Abhydrolase_1: alpha/beta hydrolase fold A web pag | 98.67 | |
| TIGR01250 | 288 | pro_imino_pep_2 proline-specific peptidases, Bacil | 98.67 | |
| PLN03087 | 481 | BODYGUARD 1 domain containing hydrolase; Provision | 98.66 | |
| KOG4409 | 365 | consensus Predicted hydrolase/acyltransferase (alp | 98.65 | |
| TIGR03611 | 257 | RutD pyrimidine utilization protein D. This protei | 98.65 | |
| PLN02511 | 388 | hydrolase | 98.65 | |
| PRK10985 | 324 | putative hydrolase; Provisional | 98.63 | |
| PRK06489 | 360 | hypothetical protein; Provisional | 98.61 | |
| PLN02894 | 402 | hydrolase, alpha/beta fold family protein | 98.57 | |
| PRK07581 | 339 | hypothetical protein; Validated | 98.53 | |
| TIGR01738 | 245 | bioH putative pimeloyl-BioC--CoA transferase BioH. | 98.51 | |
| TIGR01249 | 306 | pro_imino_pep_1 proline iminopeptidase, Neisseria- | 98.51 | |
| TIGR01392 | 351 | homoserO_Ac_trn homoserine O-acetyltransferase. Th | 98.41 | |
| PRK14875 | 371 | acetoin dehydrogenase E2 subunit dihydrolipoyllysi | 98.41 | |
| COG1075 | 336 | LipA Predicted acetyltransferases and hydrolases w | 98.38 | |
| PF05057 | 217 | DUF676: Putative serine esterase (DUF676); InterPr | 98.38 | |
| KOG1454 | 326 | consensus Predicted hydrolase/acyltransferase (alp | 98.38 | |
| TIGR01838 | 532 | PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, | 98.33 | |
| COG1647 | 243 | Esterase/lipase [General function prediction only] | 98.33 | |
| PRK05077 | 414 | frsA fermentation/respiration switch protein; Revi | 98.32 | |
| PLN02872 | 395 | triacylglycerol lipase | 98.17 | |
| PRK05855 | 582 | short chain dehydrogenase; Validated | 98.17 | |
| PF12695 | 145 | Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 | 98.16 | |
| PRK00175 | 379 | metX homoserine O-acetyltransferase; Provisional | 98.15 | |
| TIGR01839 | 560 | PHA_synth_II poly(R)-hydroxyalkanoic acid synthase | 98.15 | |
| PRK10566 | 249 | esterase; Provisional | 98.09 | |
| PLN02980 | 1655 | 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi | 98.08 | |
| PRK13604 | 307 | luxD acyl transferase; Provisional | 98.05 | |
| TIGR03230 | 442 | lipo_lipase lipoprotein lipase. Members of this pr | 98.04 | |
| KOG2564 | 343 | consensus Predicted acetyltransferases and hydrola | 98.03 | |
| PRK11071 | 190 | esterase YqiA; Provisional | 98.01 | |
| cd00707 | 275 | Pancreat_lipase_like Pancreatic lipase-like enzyme | 98.0 | |
| PLN00021 | 313 | chlorophyllase | 98.0 | |
| PF00326 | 213 | Peptidase_S9: Prolyl oligopeptidase family This fa | 97.91 | |
| KOG3724 | 973 | consensus Negative regulator of COPII vesicle form | 97.89 | |
| PRK07868 | 994 | acyl-CoA synthetase; Validated | 97.83 | |
| TIGR01840 | 212 | esterase_phb esterase, PHB depolymerase family. Th | 97.8 | |
| TIGR03502 | 792 | lipase_Pla1_cef extracellular lipase, Pla-1/cef fa | 97.78 | |
| KOG2382 | 315 | consensus Predicted alpha/beta hydrolase [General | 97.71 | |
| cd00741 | 153 | Lipase Lipase. Lipases are esterases that can hydr | 97.68 | |
| COG0596 | 282 | MhpC Predicted hydrolases or acyltransferases (alp | 97.68 | |
| PF10230 | 266 | DUF2305: Uncharacterised conserved protein (DUF230 | 97.67 | |
| PLN02442 | 283 | S-formylglutathione hydrolase | 97.67 | |
| PF00975 | 229 | Thioesterase: Thioesterase domain; InterPro: IPR00 | 97.65 | |
| KOG1838 | 409 | consensus Alpha/beta hydrolase [General function p | 97.64 | |
| PRK06765 | 389 | homoserine O-acetyltransferase; Provisional | 97.6 | |
| COG4814 | 288 | Uncharacterized protein with an alpha/beta hydrola | 97.56 | |
| TIGR00976 | 550 | /NonD putative hydrolase, CocE/NonD family. This m | 97.54 | |
| COG0429 | 345 | Predicted hydrolase of the alpha/beta-hydrolase fo | 97.51 | |
| PF12740 | 259 | Chlorophyllase2: Chlorophyllase enzyme; InterPro: | 97.51 | |
| PF06057 | 192 | VirJ: Bacterial virulence protein (VirJ); InterPro | 97.48 | |
| PF06821 | 171 | Ser_hydrolase: Serine hydrolase; InterPro: IPR0106 | 97.43 | |
| PF06342 | 297 | DUF1057: Alpha/beta hydrolase of unknown function | 97.41 | |
| PRK11460 | 232 | putative hydrolase; Provisional | 97.39 | |
| PF01764 | 140 | Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr | 97.37 | |
| TIGR02821 | 275 | fghA_ester_D S-formylglutathione hydrolase. This m | 97.36 | |
| KOG2029 | 697 | consensus Uncharacterized conserved protein [Funct | 97.28 | |
| PF08538 | 303 | DUF1749: Protein of unknown function (DUF1749); In | 97.27 | |
| KOG2624 | 403 | consensus Triglyceride lipase-cholesterol esterase | 97.18 | |
| PF05990 | 233 | DUF900: Alpha/beta hydrolase of unknown function ( | 97.17 | |
| COG3545 | 181 | Predicted esterase of the alpha/beta hydrolase fol | 97.14 | |
| cd00519 | 229 | Lipase_3 Lipase (class 3). Lipases are esterases t | 97.12 | |
| PLN02633 | 314 | palmitoyl protein thioesterase family protein | 97.07 | |
| COG4757 | 281 | Predicted alpha/beta hydrolase [General function p | 96.99 | |
| COG3243 | 445 | PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid me | 96.98 | |
| PLN02606 | 306 | palmitoyl-protein thioesterase | 96.96 | |
| PF02089 | 279 | Palm_thioest: Palmitoyl protein thioesterase; Inte | 96.8 | |
| PF01083 | 179 | Cutinase: Cutinase; InterPro: IPR000675 Aerial pla | 96.76 | |
| PRK10162 | 318 | acetyl esterase; Provisional | 96.73 | |
| TIGR01849 | 406 | PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, | 96.72 | |
| KOG4667 | 269 | consensus Predicted esterase [Lipid transport and | 96.7 | |
| smart00824 | 212 | PKS_TE Thioesterase. Peptide synthetases are invol | 96.68 | |
| COG3208 | 244 | GrsT Predicted thioesterase involved in non-riboso | 96.61 | |
| PF07224 | 307 | Chlorophyllase: Chlorophyllase; InterPro: IPR01082 | 96.52 | |
| PF07082 | 250 | DUF1350: Protein of unknown function (DUF1350); In | 96.51 | |
| KOG1552 | 258 | consensus Predicted alpha/beta hydrolase [General | 96.48 | |
| COG2819 | 264 | Predicted hydrolase of the alpha/beta superfamily | 96.47 | |
| PLN00413 | 479 | triacylglycerol lipase | 96.46 | |
| PF06500 | 411 | DUF1100: Alpha/beta hydrolase of unknown function | 96.46 | |
| PLN02162 | 475 | triacylglycerol lipase | 96.4 | |
| COG4782 | 377 | Uncharacterized protein conserved in bacteria [Fun | 96.39 | |
| PF11187 | 224 | DUF2974: Protein of unknown function (DUF2974); In | 96.39 | |
| PF06259 | 177 | Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR | 96.35 | |
| COG2945 | 210 | Predicted hydrolase of the alpha/beta superfamily | 96.24 | |
| PF05277 | 345 | DUF726: Protein of unknown function (DUF726); Inte | 96.24 | |
| PF00756 | 251 | Esterase: Putative esterase; InterPro: IPR000801 T | 96.22 | |
| COG3319 | 257 | Thioesterase domains of type I polyketide synthase | 96.21 | |
| PF07859 | 211 | Abhydrolase_3: alpha/beta hydrolase fold A web pag | 96.2 | |
| PF02230 | 216 | Abhydrolase_2: Phospholipase/Carboxylesterase; Int | 96.19 | |
| KOG2541 | 296 | consensus Palmitoyl protein thioesterase [Lipid tr | 96.19 | |
| COG2021 | 368 | MET2 Homoserine acetyltransferase [Amino acid tran | 96.14 | |
| PRK10252 | 1296 | entF enterobactin synthase subunit F; Provisional | 96.1 | |
| PF01738 | 218 | DLH: Dienelactone hydrolase family; InterPro: IPR0 | 96.07 | |
| PLN02934 | 515 | triacylglycerol lipase | 96.0 | |
| PLN02454 | 414 | triacylglycerol lipase | 95.99 | |
| PF05728 | 187 | UPF0227: Uncharacterised protein family (UPF0227); | 95.79 | |
| COG0412 | 236 | Dienelactone hydrolase and related enzymes [Second | 95.76 | |
| PLN02408 | 365 | phospholipase A1 | 95.7 | |
| PLN02310 | 405 | triacylglycerol lipase | 95.66 | |
| PRK10439 | 411 | enterobactin/ferric enterobactin esterase; Provisi | 95.49 | |
| KOG4840 | 299 | consensus Predicted hydrolases or acyltransferases | 95.42 | |
| PF12146 | 79 | Hydrolase_4: Putative lysophospholipase; InterPro: | 95.39 | |
| COG3571 | 213 | Predicted hydrolase of the alpha/beta-hydrolase fo | 95.27 | |
| PF11288 | 207 | DUF3089: Protein of unknown function (DUF3089); In | 95.12 | |
| KOG2984 | 277 | consensus Predicted hydrolase [General function pr | 95.09 | |
| PF12048 | 310 | DUF3530: Protein of unknown function (DUF3530); In | 95.07 | |
| PRK05371 | 767 | x-prolyl-dipeptidyl aminopeptidase; Provisional | 95.01 | |
| PF00151 | 331 | Lipase: Lipase; InterPro: IPR013818 Triglyceride l | 94.83 | |
| COG1506 | 620 | DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept | 94.74 | |
| KOG1553 | 517 | consensus Predicted alpha/beta hydrolase BAT5 [Gen | 94.71 | |
| PLN02571 | 413 | triacylglycerol lipase | 94.61 | |
| PRK04940 | 180 | hypothetical protein; Provisional | 94.49 | |
| PF10503 | 220 | Esterase_phd: Esterase PHB depolymerase | 94.46 | |
| PLN03037 | 525 | lipase class 3 family protein; Provisional | 94.36 | |
| PF02129 | 272 | Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 fam | 94.22 | |
| PLN02802 | 509 | triacylglycerol lipase | 94.04 | |
| PLN02847 | 633 | triacylglycerol lipase | 94.02 | |
| PLN02324 | 415 | triacylglycerol lipase | 94.01 | |
| COG0400 | 207 | Predicted esterase [General function prediction on | 93.75 | |
| KOG4627 | 270 | consensus Kynurenine formamidase [Amino acid trans | 93.65 | |
| PF08840 | 213 | BAAT_C: BAAT / Acyl-CoA thioester hydrolase C term | 93.6 | |
| PLN02719 | 518 | triacylglycerol lipase | 93.24 | |
| PLN02753 | 531 | triacylglycerol lipase | 93.23 | |
| PRK10115 | 686 | protease 2; Provisional | 93.2 | |
| PF05677 | 365 | DUF818: Chlamydia CHLPS protein (DUF818); InterPro | 93.18 | |
| PF12715 | 390 | Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8 | 93.1 | |
| KOG3967 | 297 | consensus Uncharacterized conserved protein [Funct | 93.1 | |
| COG0657 | 312 | Aes Esterase/lipase [Lipid metabolism] | 93.05 | |
| PTZ00472 | 462 | serine carboxypeptidase (CBP1); Provisional | 92.73 | |
| PF03583 | 290 | LIP: Secretory lipase ; InterPro: IPR005152 This e | 92.61 | |
| PLN02761 | 527 | lipase class 3 family protein | 92.37 | |
| COG3946 | 456 | VirJ Type IV secretory pathway, VirJ component [In | 91.79 | |
| KOG3975 | 301 | consensus Uncharacterized conserved protein [Funct | 91.32 | |
| COG4188 | 365 | Predicted dienelactone hydrolase [General function | 91.02 | |
| KOG4569 | 336 | consensus Predicted lipase [Lipid transport and me | 90.97 | |
| PF05577 | 434 | Peptidase_S28: Serine carboxypeptidase S28; InterP | 90.18 | |
| PF05448 | 320 | AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0 | 89.54 | |
| COG0627 | 316 | Predicted esterase [General function prediction on | 89.2 | |
| KOG4372 | 405 | consensus Predicted alpha/beta hydrolase [General | 87.78 | |
| KOG1515 | 336 | consensus Arylacetamide deacetylase [Defense mecha | 87.69 | |
| COG4099 | 387 | Predicted peptidase [General function prediction o | 85.99 | |
| KOG2281 | 867 | consensus Dipeptidyl aminopeptidases/acylaminoacyl | 85.2 | |
| PF11339 | 581 | DUF3141: Protein of unknown function (DUF3141); In | 84.92 | |
| PF08237 | 225 | PE-PPE: PE-PPE domain; InterPro: IPR013228 The hum | 84.73 | |
| KOG4391 | 300 | consensus Predicted alpha/beta hydrolase BEM46 [Ge | 84.01 | |
| KOG2385 | 633 | consensus Uncharacterized conserved protein [Funct | 83.97 | |
| KOG4540 | 425 | consensus Putative lipase essential for disintegra | 82.1 | |
| COG5153 | 425 | CVT17 Putative lipase essential for disintegration | 82.1 | |
| KOG2183 | 492 | consensus Prolylcarboxypeptidase (angiotensinase C | 80.44 |
| >PLN02733 phosphatidylcholine-sterol O-acyltransferase | Back alignment and domain information |
|---|
Probab=100.00 E-value=6.7e-74 Score=587.48 Aligned_cols=415 Identities=66% Similarity=1.164 Sum_probs=365.1
Q ss_pred CCCCCCCCCEEEeCCccccccEeeecCCCccccceeechhchHHHHHHhhccccCCCCCccccCCCceEEecCCCCCcce
Q 013182 14 RQTESEVDPVLLVSGMGGSVLHAKRKKLGCETRVWVRILLAELEFKRKVWSRYNPKTGYTESLDKDTEIVVPEDDYGLYA 93 (448)
Q Consensus 14 ~~~~~~~~PviliPG~~gS~L~~~~~~~~~~~~~W~~~~~~~~~~~~~~~l~~d~~t~~~~~~~~g~~i~~p~~~~G~~~ 93 (448)
...+..++|||||||++||+|+++.++....+++|+++|++++|+.+||++.||++|++++|.+|||+|++|++.+|+++
T Consensus 13 ~~~~~~~~PViLvPG~~gS~L~a~~~~~~~~~~~W~~l~~~~~~~~~~l~~~yd~~t~~~~~~~~gv~i~vp~~~~g~~~ 92 (440)
T PLN02733 13 PYVDPDLDPVLLVPGIGGSILNAVDKDGGNEERVWVRIFAADHEFRKKLWSRYDPKTGKTVSLDPKTEIVVPDDRYGLYA 92 (440)
T ss_pred CCCCCCCCcEEEeCCCCcceeEEeecCCCCccceeEEchhcCHHHHHHhhheeCcccCceecCCCCceEEcCCCCCCcee
Confidence 45667899999999999999999875444468999999999999999999999999999999878999999976458999
Q ss_pred eeecCcchhhhhccccchhhHHHHHHHHHHCCCeeecCcccCCCCCCCCchHHHHHHHHHHHHHHHHHHhCCCcEEEEEe
Q 013182 94 IDILDPSFILKLIHFTEVYHFHDMIEMLVKCGYKKGTTLFGYGYDFRQSNRIDKLMEGLKVKLETAYKASGNRKVTLITH 173 (448)
Q Consensus 94 i~~l~~~~~~~~~~~~~~~~~~~l~~~L~~~Gy~v~~dl~g~~yd~r~~~~~~~~~~~L~~~Ie~~~~~~~~~kv~LVGH 173 (448)
++++||..+.+ ....++|+.+++.|++.||.++.|++|||||||.++..++++++|+++|++++++++.+||+||||
T Consensus 93 i~~ldp~~~~~---~~~~~~~~~li~~L~~~GY~~~~dL~g~gYDwR~~~~~~~~~~~Lk~lIe~~~~~~g~~kV~LVGH 169 (440)
T PLN02733 93 IDILDPDVIIR---LDEVYYFHDMIEQLIKWGYKEGKTLFGFGYDFRQSNRLPETMDGLKKKLETVYKASGGKKVNIISH 169 (440)
T ss_pred eEEecCccccC---cchHHHHHHHHHHHHHcCCccCCCcccCCCCccccccHHHHHHHHHHHHHHHHHHcCCCCEEEEEE
Confidence 99999986433 234578999999999999999899999999999987677889999999999999888899999999
Q ss_pred ChhHHHHHHHHHhcCccccccccEEEEEcCCCCCChHHHHHHHHhhhhHHhhhhhhcccchHHHHHHHHhcccccccccC
Q 013182 174 SMGGLLVMCFMSLHKDVFSKFVNKWITIASPFQGAPGCINDSLLTGLQFVEGIASFFFVSRWTMHQLLVECPSIYEMLAN 253 (448)
Q Consensus 174 SMGGlva~~~l~~~~~~~~~~V~~~I~i~~P~~Gs~~a~~~~l~~G~~~~~~l~~~~~~~~~~~~~~~~~~~s~~~LLP~ 253 (448)
||||+++++|+..+|++|+++|+++|+||+|+.|+++++...+++|..++.++...++++++.+++++|++||+++|||+
T Consensus 170 SMGGlva~~fl~~~p~~~~k~I~~~I~la~P~~Gs~~~i~~~l~~g~~~v~~~~~~~~~s~~~~~~~~rs~~s~~~llP~ 249 (440)
T PLN02733 170 SMGGLLVKCFMSLHSDVFEKYVNSWIAIAAPFQGAPGFITDSLLTGVSFVEGWESEFFVSKWSMHQLLIECPSIYELMAN 249 (440)
T ss_pred CHhHHHHHHHHHHCCHhHHhHhccEEEECCCCCCCchhHHHHHhcCchhhhhhhhhhccCHHHHHHHHHhcccHHHHcCC
Confidence 99999999999999998889999999999999999999554799999888888777888999999999999999999999
Q ss_pred CCCCCCCccceeeccccCCC-CCCCceeeeeCCCchhhhHHHHhhcccccCCCccccccchhhHHHHhhhhhhhhhcCCC
Q 013182 254 PDFKWKKQPQIKVWRKQSND-GESSAKLETYGPVESISLFKEALRNNELDYNGNSIALPFNFAILDWAAGTRQIINNAQL 332 (448)
Q Consensus 254 ~~~~~~~~~~~~~~~~~~~~-~d~~~~~~~y~~~D~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 332 (448)
+.+.|++++.+++||+.... +.....+.+|++.|+.++|+++++++.+.|+++.+.++++.++++|++++++++.+++.
T Consensus 250 ~~~~w~~~~~~~~~~~~~~~~g~~~~~~~~Y~~~d~~~~~~~~~~~g~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~ 329 (440)
T PLN02733 250 PDFKWEEPPELQVWRKKSDNDGNSSVVLESYGPLESIEVFEDALSNNTLNYDGEKIPLPFNFDILKWANETRRILSSAKL 329 (440)
T ss_pred CCCCCCCCceEEEeeeccCCCCcccccccccCHHHHHHHHHHHHhcCceecccccccCcchHHHHHHHHHhHhhhccCCC
Confidence 98669988888889752211 11112256799999999999998888888999999999999888888899999999988
Q ss_pred CCCCcEEEEEcCCCCcceeeeeCCCCCCCCcccccccCCCCceecCCCccccccccccCCCCceeeecCCccccccccCh
Q 013182 333 PNGVSYYNIYGTSYDTPFDVSYGSETSPIEDLSEICHTMPKYSFVDGDGTVPAESAKADGFPAVERVGVPAEHRELLRDK 412 (448)
Q Consensus 333 p~~v~~~~iyG~g~~T~~~~~y~~~~~~~~~~~~~~~~~p~~~~~~GDGTVp~~S~~~~~~~~~~~~~~~~~H~~il~~~ 412 (448)
||+|++|||||+|++|+.++.|+++..|+.+.+..++..|++++++||||||.+|+++|++....+.+.+++|.+|+.|+
T Consensus 330 p~~V~~yciygsg~~T~~~~~y~~~~~~~~~~~~~~~~~p~~~y~dGDGTV~~~S~~~~~~~~~~~~~l~~~H~~il~n~ 409 (440)
T PLN02733 330 PKGVKFYNIYGTSLDTPFDVCYGSEKSPIEDLSEILHTEPEYTYVDGDGTVPVESAKADGLNAVARVGVPGDHRGILRDE 409 (440)
T ss_pred CCCceEEEEecCCCCCcceEEecCCCCcccchhhhcccCceEEEeCCCCEEecchhhccCccccccccCCchHHHHhcCH
Confidence 99999999999999999999999887787777777788899999999999999999999865555677789999999999
Q ss_pred HHHHHHHHHhcCCCCcccc
Q 013182 413 TVFELIKKWLGVDQKMSKH 431 (448)
Q Consensus 413 ~~~~~i~~il~~~~~~~~~ 431 (448)
+++++|+++|..++-...-
T Consensus 410 ~v~~~I~~fL~~g~f~~~~ 428 (440)
T PLN02733 410 HVFRILKHWLKVGEPDPFY 428 (440)
T ss_pred HHHHHHHHHHhcCCCcccc
Confidence 9999999999877655443
|
|
| >PLN02517 phosphatidylcholine-sterol O-acyltransferase | Back alignment and domain information |
|---|
| >KOG2369 consensus Lecithin:cholesterol acyltransferase (LCAT)/Acyl-ceramide synthase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PF02450 LCAT: Lecithin:cholesterol acyltransferase; InterPro: IPR003386 Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (2 | Back alignment and domain information |
|---|
| >COG2267 PldB Lysophospholipase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like | Back alignment and domain information |
|---|
| >PLN02965 Probable pheophorbidase | Back alignment and domain information |
|---|
| >PRK10749 lysophospholipase L2; Provisional | Back alignment and domain information |
|---|
| >PHA02857 monoglyceride lipase; Provisional | Back alignment and domain information |
|---|
| >PLN02824 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >PRK00870 haloalkane dehalogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02298 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >PRK03592 haloalkane dehalogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02385 hydrolase; alpha/beta fold family protein | Back alignment and domain information |
|---|
| >TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase | Back alignment and domain information |
|---|
| >PLN02211 methyl indole-3-acetate methyltransferase | Back alignment and domain information |
|---|
| >PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A | Back alignment and domain information |
|---|
| >TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) | Back alignment and domain information |
|---|
| >TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated | Back alignment and domain information |
|---|
| >PF01674 Lipase_2: Lipase (class 2); InterPro: IPR002918 Lipases or triacylglycerol acylhydrolases hydrolyse ester bonds in triacylglycerol giving diacylglycerol, monoacylglycerol, glycerol and free fatty acids [] | Back alignment and domain information |
|---|
| >PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional | Back alignment and domain information |
|---|
| >PRK03204 haloalkane dehalogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02679 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >PRK08775 homoserine O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) | Back alignment and domain information |
|---|
| >PRK10349 carboxylesterase BioH; Provisional | Back alignment and domain information |
|---|
| >PLN03084 alpha/beta hydrolase fold protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein | Back alignment and domain information |
|---|
| >KOG4178 consensus Soluble epoxide hydrolase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit | Back alignment and domain information |
|---|
| >TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase | Back alignment and domain information |
|---|
| >PRK10673 acyl-CoA esterase; Provisional | Back alignment and domain information |
|---|
| >TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated | Back alignment and domain information |
|---|
| >PLN02578 hydrolase | Back alignment and domain information |
|---|
| >TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase | Back alignment and domain information |
|---|
| >TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase | Back alignment and domain information |
|---|
| >KOG1455 consensus Lysophospholipase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02652 hydrolase; alpha/beta fold family protein | Back alignment and domain information |
|---|
| >PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases | Back alignment and domain information |
|---|
| >TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily | Back alignment and domain information |
|---|
| >PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional | Back alignment and domain information |
|---|
| >KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03611 RutD pyrimidine utilization protein D | Back alignment and domain information |
|---|
| >PLN02511 hydrolase | Back alignment and domain information |
|---|
| >PRK10985 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK06489 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02894 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >PRK07581 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH | Back alignment and domain information |
|---|
| >TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily | Back alignment and domain information |
|---|
| >TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase | Back alignment and domain information |
|---|
| >PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1075 LipA Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
| >PF05057 DUF676: Putative serine esterase (DUF676); InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases | Back alignment and domain information |
|---|
| >KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I | Back alignment and domain information |
|---|
| >COG1647 Esterase/lipase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05077 frsA fermentation/respiration switch protein; Reviewed | Back alignment and domain information |
|---|
| >PLN02872 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PRK05855 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A | Back alignment and domain information |
|---|
| >PRK00175 metX homoserine O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II | Back alignment and domain information |
|---|
| >PRK10566 esterase; Provisional | Back alignment and domain information |
|---|
| >PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding | Back alignment and domain information |
|---|
| >PRK13604 luxD acyl transferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03230 lipo_lipase lipoprotein lipase | Back alignment and domain information |
|---|
| >KOG2564 consensus Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11071 esterase YqiA; Provisional | Back alignment and domain information |
|---|
| >cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes | Back alignment and domain information |
|---|
| >PLN00021 chlorophyllase | Back alignment and domain information |
|---|
| >PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification | Back alignment and domain information |
|---|
| >KOG3724 consensus Negative regulator of COPII vesicle formation [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK07868 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >TIGR01840 esterase_phb esterase, PHB depolymerase family | Back alignment and domain information |
|---|
| >TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family | Back alignment and domain information |
|---|
| >KOG2382 consensus Predicted alpha/beta hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >cd00741 Lipase Lipase | Back alignment and domain information |
|---|
| >COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function | Back alignment and domain information |
|---|
| >PLN02442 S-formylglutathione hydrolase | Back alignment and domain information |
|---|
| >PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] | Back alignment and domain information |
|---|
| >KOG1838 consensus Alpha/beta hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06765 homoserine O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG4814 Uncharacterized protein with an alpha/beta hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00976 /NonD putative hydrolase, CocE/NonD family | Back alignment and domain information |
|---|
| >COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
| >PF12740 Chlorophyllase2: Chlorophyllase enzyme; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 | Back alignment and domain information |
|---|
| >PF06057 VirJ: Bacterial virulence protein (VirJ); InterPro: IPR010333 This entry contains several bacterial VirJ virulence proteins | Back alignment and domain information |
|---|
| >PF06821 Ser_hydrolase: Serine hydrolase; InterPro: IPR010662 This family contains a number of hypothetical bacterial proteins of unknown function, which may be cytosolic | Back alignment and domain information |
|---|
| >PF06342 DUF1057: Alpha/beta hydrolase of unknown function (DUF1057); InterPro: IPR010463 This entry consists of proteins of unknown function which have an alpha/beta hydrolase fold | Back alignment and domain information |
|---|
| >PRK11460 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] | Back alignment and domain information |
|---|
| >TIGR02821 fghA_ester_D S-formylglutathione hydrolase | Back alignment and domain information |
|---|
| >KOG2029 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF08538 DUF1749: Protein of unknown function (DUF1749); InterPro: IPR013744 This is a plant and fungal family of unknown function | Back alignment and domain information |
|---|
| >KOG2624 consensus Triglyceride lipase-cholesterol esterase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like | Back alignment and domain information |
|---|
| >COG3545 Predicted esterase of the alpha/beta hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
| >cd00519 Lipase_3 Lipase (class 3) | Back alignment and domain information |
|---|
| >PLN02633 palmitoyl protein thioesterase family protein | Back alignment and domain information |
|---|
| >COG4757 Predicted alpha/beta hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >COG3243 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PLN02606 palmitoyl-protein thioesterase | Back alignment and domain information |
|---|
| >PF02089 Palm_thioest: Palmitoyl protein thioesterase; InterPro: IPR002472 Neuronal ceroid lipofuscinoses (NCL) represent a group of encephalopathies that occur in 1 in 12,500 children | Back alignment and domain information |
|---|
| >PF01083 Cutinase: Cutinase; InterPro: IPR000675 Aerial plant organs are protected by a cuticle composed of an insoluble polymeric structural compound, cutin, which is a polyester composed of hydroxy and hydroxyepoxy fatty acids [] | Back alignment and domain information |
|---|
| >PRK10162 acetyl esterase; Provisional | Back alignment and domain information |
|---|
| >TIGR01849 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, intracellular | Back alignment and domain information |
|---|
| >KOG4667 consensus Predicted esterase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >smart00824 PKS_TE Thioesterase | Back alignment and domain information |
|---|
| >COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PF07224 Chlorophyllase: Chlorophyllase; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 | Back alignment and domain information |
|---|
| >PF07082 DUF1350: Protein of unknown function (DUF1350); InterPro: IPR010765 This family consists of several hypothetical proteins from both cyanobacteria and plants | Back alignment and domain information |
|---|
| >KOG1552 consensus Predicted alpha/beta hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >COG2819 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PLN00413 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PF06500 DUF1100: Alpha/beta hydrolase of unknown function (DUF1100); InterPro: IPR010520 Proteins in this entry display esterase activity toward pNP-butyrate [] | Back alignment and domain information |
|---|
| >PLN02162 triacylglycerol lipase | Back alignment and domain information |
|---|
| >COG4782 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF11187 DUF2974: Protein of unknown function (DUF2974); InterPro: IPR024499 This family of proteins has no known function | Back alignment and domain information |
|---|
| >PF06259 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR010427 This is a family of uncharacterised proteins found in Actinobacteria | Back alignment and domain information |
|---|
| >COG2945 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PF05277 DUF726: Protein of unknown function (DUF726); InterPro: IPR007941 This family consists of several uncharacterised eukaryotic proteins | Back alignment and domain information |
|---|
| >PF00756 Esterase: Putative esterase; InterPro: IPR000801 This family contains several seemingly unrelated proteins, including human esterase D; mycobacterial antigen 85, which is responsible for the high affinity of mycobacteria to fibronectin; Corynebacterium glutamicum major secreted protein PS1; and hypothetical proteins from Escherichia coli, yeast, mycobacteria and Haemophilus influenzae | Back alignment and domain information |
|---|
| >COG3319 Thioesterase domains of type I polyketide synthases or non-ribosomal peptide synthetases [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases | Back alignment and domain information |
|---|
| >PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases | Back alignment and domain information |
|---|
| >KOG2541 consensus Palmitoyl protein thioesterase [Lipid transport and metabolism; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG2021 MET2 Homoserine acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10252 entF enterobactin synthase subunit F; Provisional | Back alignment and domain information |
|---|
| >PF01738 DLH: Dienelactone hydrolase family; InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway | Back alignment and domain information |
|---|
| >PLN02934 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PLN02454 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO | Back alignment and domain information |
|---|
| >COG0412 Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PLN02408 phospholipase A1 | Back alignment and domain information |
|---|
| >PLN02310 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PRK10439 enterobactin/ferric enterobactin esterase; Provisional | Back alignment and domain information |
|---|
| >KOG4840 consensus Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PF12146 Hydrolase_4: Putative lysophospholipase; InterPro: IPR022742 This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length | Back alignment and domain information |
|---|
| >COG3571 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
| >PF11288 DUF3089: Protein of unknown function (DUF3089); InterPro: IPR021440 This family of proteins has no known function | Back alignment and domain information |
|---|
| >KOG2984 consensus Predicted hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PF12048 DUF3530: Protein of unknown function (DUF3530); InterPro: IPR022529 This family of proteins is functionally uncharacterised | Back alignment and domain information |
|---|
| >PRK05371 x-prolyl-dipeptidyl aminopeptidase; Provisional | Back alignment and domain information |
|---|
| >PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3 | Back alignment and domain information |
|---|
| >COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1553 consensus Predicted alpha/beta hydrolase BAT5 [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02571 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PRK04940 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF10503 Esterase_phd: Esterase PHB depolymerase | Back alignment and domain information |
|---|
| >PLN03037 lipase class 3 family protein; Provisional | Back alignment and domain information |
|---|
| >PF02129 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 family); InterPro: IPR000383 This entry represents a domain found peptidases Xaa-Pro dipeptidyl-peptidase and glutaryl-7-aminocephalosporanic-acid acylase, which belong to MEROPS peptidase families S15 and S45 respectively [] | Back alignment and domain information |
|---|
| >PLN02802 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PLN02847 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PLN02324 triacylglycerol lipase | Back alignment and domain information |
|---|
| >COG0400 Predicted esterase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4627 consensus Kynurenine formamidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF08840 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C terminal; InterPro: IPR014940 Acyl-CoA thioesterases are a group of enzymes that catalyse the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH | Back alignment and domain information |
|---|
| >PLN02719 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PLN02753 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PRK10115 protease 2; Provisional | Back alignment and domain information |
|---|
| >PF05677 DUF818: Chlamydia CHLPS protein (DUF818); InterPro: IPR008536 This family of unknown function includes several Chlamydia CHLPS proteins and Legionella SidB proteins | Back alignment and domain information |
|---|
| >PF12715 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8Y_A | Back alignment and domain information |
|---|
| >KOG3967 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG0657 Aes Esterase/lipase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PTZ00472 serine carboxypeptidase (CBP1); Provisional | Back alignment and domain information |
|---|
| >PF03583 LIP: Secretory lipase ; InterPro: IPR005152 This entry represents a family of secreted lipases | Back alignment and domain information |
|---|
| >PLN02761 lipase class 3 family protein | Back alignment and domain information |
|---|
| >COG3946 VirJ Type IV secretory pathway, VirJ component [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG3975 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4188 Predicted dienelactone hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4569 consensus Predicted lipase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PF05577 Peptidase_S28: Serine carboxypeptidase S28; InterPro: IPR008758 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins | Back alignment and domain information |
|---|
| >COG0627 Predicted esterase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4372 consensus Predicted alpha/beta hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1515 consensus Arylacetamide deacetylase [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG4099 Predicted peptidase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2281 consensus Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11339 DUF3141: Protein of unknown function (DUF3141); InterPro: IPR024501 This family of proteins appears to be predominantly expressed in Proteobacteria | Back alignment and domain information |
|---|
| >PF08237 PE-PPE: PE-PPE domain; InterPro: IPR013228 The human pathogen Mycobacterium tuberculosis harbours a large number of genes that encode proteins whose N-termini contain the characteristic motifs Pro-Glu (PE) or Pro-Pro-Glu (PPE) | Back alignment and domain information |
|---|
| >KOG4391 consensus Predicted alpha/beta hydrolase BEM46 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2385 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4540 consensus Putative lipase essential for disintegration of autophagic bodies inside the vacuole [Intracellular trafficking, secretion, and vesicular transport; Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >COG5153 CVT17 Putative lipase essential for disintegration of autophagic bodies inside the vacuole [Intracellular trafficking and secretion / Lipid metabolism] | Back alignment and domain information |
|---|
| >KOG2183 consensus Prolylcarboxypeptidase (angiotensinase C) [Posttranslational modification, protein turnover, chaperones; General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 448 | |||
| 1isp_A | 181 | Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 | 5e-12 | |
| 2x5x_A | 342 | PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE | 3e-07 | |
| 3lp5_A | 250 | Putative cell surface hydrolase; structural genom | 3e-07 | |
| 3fle_A | 249 | SE_1780 protein; structural genomics, APC61035.1, | 7e-07 | |
| 1ex9_A | 285 | Lactonizing lipase; alpha-beta hydrolase fold, pho | 1e-06 | |
| 1tca_A | 317 | Lipase; hydrolase(carboxylic esterase); HET: NAG; | 2e-06 | |
| 3icv_A | 316 | Lipase B, CALB; circular permutation, cleavage on | 2e-06 | |
| 1ys1_X | 320 | Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h | 9e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 9e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 9e-05 | |
| 3ds8_A | 254 | LIN2722 protein; unkonwn function, structural geno | 1e-05 | |
| 2zyr_A | 484 | Lipase, putative; fatty acid, hydrolase; HET: 1PE; | 1e-04 | |
| 4f0j_A | 315 | Probable hydrolytic enzyme; alpha/beta hydrolase f | 3e-04 | |
| 2rau_A | 354 | Putative esterase; NP_343859.1, putative lipase, s | 4e-04 | |
| 3l80_A | 292 | Putative uncharacterized protein SMU.1393C; alpha/ | 7e-04 |
| >1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Length = 181 | Back alignment and structure |
|---|
Score = 63.2 bits (154), Expect = 5e-12
Identities = 23/141 (16%), Positives = 49/141 (34%), Gaps = 15/141 (10%)
Query: 105 LIH---FTEVYHFHDMIEMLVKCGYKKGTTLFGYGYDFRQSNRIDKLMEGLKVKLETAYK 161
++H F + LV G+ + L+ + + L ++
Sbjct: 8 MVHGIGGASFN-FAGIKSYLVSQGWSRDK-LYAVDFWDKTGT-NYNNGPVLSRFVQKVLD 64
Query: 162 ASGNRKVTLITHSMGGLLVMCFMSLHKDVFSKFVNKWITIASPFQGAPGCINDSLLTGLQ 221
+G +KV ++ HSMGG + ++ V +T+ + G L G
Sbjct: 65 ETGAKKVDIVAHSMGGANTLYYIKNLDG--GNKVANVVTLGGANRLTTGK----ALPGTD 118
Query: 222 FVEGIASFFFVSRWTMHQLLV 242
+ I + S ++ ++V
Sbjct: 119 PNQKIL---YTSIYSSADMIV 136
|
| >2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Length = 342 | Back alignment and structure |
|---|
| >3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Length = 250 | Back alignment and structure |
|---|
| >3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} Length = 249 | Back alignment and structure |
|---|
| >1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Length = 285 | Back alignment and structure |
|---|
| >1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Length = 317 | Back alignment and structure |
|---|
| >3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Length = 316 | Back alignment and structure |
|---|
| >1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Length = 320 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Length = 254 | Back alignment and structure |
|---|
| >2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* Length = 484 | Back alignment and structure |
|---|
| >4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Length = 315 | Back alignment and structure |
|---|
| >2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Length = 354 | Back alignment and structure |
|---|
| >3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Length = 292 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 448 | |||
| 3fle_A | 249 | SE_1780 protein; structural genomics, APC61035.1, | 99.51 | |
| 1ex9_A | 285 | Lactonizing lipase; alpha-beta hydrolase fold, pho | 99.44 | |
| 3lp5_A | 250 | Putative cell surface hydrolase; structural genom | 99.42 | |
| 3ds8_A | 254 | LIN2722 protein; unkonwn function, structural geno | 99.38 | |
| 3icv_A | 316 | Lipase B, CALB; circular permutation, cleavage on | 99.26 | |
| 2cjp_A | 328 | Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu | 99.25 | |
| 1zoi_A | 276 | Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo | 99.22 | |
| 2wfl_A | 264 | Polyneuridine-aldehyde esterase; alkaloid metaboli | 99.22 | |
| 3c6x_A | 257 | Hydroxynitrilase; atomic resolution, hydroxynitril | 99.21 | |
| 3om8_A | 266 | Probable hydrolase; structural genomics, PSI-2, pr | 99.21 | |
| 1ehy_A | 294 | Protein (soluble epoxide hydrolase); alpha/beta hy | 99.2 | |
| 2xt0_A | 297 | Haloalkane dehalogenase; hydrolase, alpha-beta hyd | 99.2 | |
| 1a8q_A | 274 | Bromoperoxidase A1; haloperoxidase, oxidoreductase | 99.2 | |
| 1xkl_A | 273 | SABP2, salicylic acid-binding protein 2; alpha-bet | 99.19 | |
| 1a88_A | 275 | Chloroperoxidase L; haloperoxidase, oxidoreductase | 99.18 | |
| 1brt_A | 277 | Bromoperoxidase A2; haloperoxidase, oxidoreductase | 99.18 | |
| 1a8s_A | 273 | Chloroperoxidase F; haloperoxidase, oxidoreductase | 99.17 | |
| 1b6g_A | 310 | Haloalkane dehalogenase; hydrolase, alpha/beta-hyd | 99.17 | |
| 1q0r_A | 298 | RDMC, aclacinomycin methylesterase; anthracycline, | 99.16 | |
| 2wj6_A | 276 | 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid | 99.16 | |
| 3ia2_A | 271 | Arylesterase; alpha-beta hydrolase fold, transitio | 99.16 | |
| 4fbl_A | 281 | LIPS lipolytic enzyme; thermostable, structural ge | 99.15 | |
| 2xmz_A | 269 | Hydrolase, alpha/beta hydrolase fold family; menaq | 99.15 | |
| 1hkh_A | 279 | Gamma lactamase; hydrolase, alpha/beta hydrolase, | 99.14 | |
| 2xua_A | 266 | PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate | 99.13 | |
| 2wue_A | 291 | 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas | 99.11 | |
| 2hih_A | 431 | Lipase 46 kDa form; A1 phospholipase, phospholipid | 99.1 | |
| 3bwx_A | 285 | Alpha/beta hydrolase; YP_496220.1, joint center fo | 99.1 | |
| 2wtm_A | 251 | EST1E; hydrolase; 1.60A {Clostridium proteoclastic | 99.09 | |
| 2ocg_A | 254 | Valacyclovir hydrolase; alpha beta hydrolase fold; | 99.09 | |
| 1ys1_X | 320 | Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h | 99.09 | |
| 3afi_E | 316 | Haloalkane dehalogenase; A/B-hydrolase, hydrolase; | 99.08 | |
| 3qit_A | 286 | CURM TE, polyketide synthase; thioesterase, alpha/ | 99.08 | |
| 3sty_A | 267 | Methylketone synthase 1; alpha/beta hydrolase, dec | 99.06 | |
| 1tca_A | 317 | Lipase; hydrolase(carboxylic esterase); HET: NAG; | 99.06 | |
| 2x5x_A | 342 | PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE | 99.05 | |
| 1iup_A | 282 | META-cleavage product hydrolase; aromatic compound | 99.05 | |
| 3fob_A | 281 | Bromoperoxidase; structural genomics, IDP00046, ba | 99.05 | |
| 1r3d_A | 264 | Conserved hypothetical protein VC1974; structural | 99.05 | |
| 3bf7_A | 255 | Esterase YBFF; thioesterase, helical CAP, hydrolas | 99.04 | |
| 2puj_A | 286 | 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; | 99.04 | |
| 1c4x_A | 285 | BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di | 99.03 | |
| 2yys_A | 286 | Proline iminopeptidase-related protein; TTHA1809, | 99.03 | |
| 3pe6_A | 303 | Monoglyceride lipase; alpha-beta hydrolase fold, 2 | 99.02 | |
| 3dqz_A | 258 | Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl | 99.01 | |
| 3v48_A | 268 | Aminohydrolase, putative aminoacrylate hydrolase R | 99.01 | |
| 3u1t_A | 309 | DMMA haloalkane dehalogenase; alpha/beta-hydrolase | 99.01 | |
| 1mtz_A | 293 | Proline iminopeptidase; alpha-beta hydrolase, CAP | 99.0 | |
| 3r40_A | 306 | Fluoroacetate dehalogenase; FACD, defluorinase, al | 99.0 | |
| 3ibt_A | 264 | 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, | 98.99 | |
| 3kda_A | 301 | CFTR inhibitory factor (CIF); alpha/beta hydrolase | 98.99 | |
| 3fsg_A | 272 | Alpha/beta superfamily hydrolase; PF00561, MCSG, P | 98.99 | |
| 1wom_A | 271 | RSBQ, sigma factor SIGB regulation protein RSBQ; a | 98.98 | |
| 1pja_A | 302 | Palmitoyl-protein thioesterase 2 precursor; hydrol | 98.98 | |
| 3pfb_A | 270 | Cinnamoyl esterase; alpha/beta hydrolase fold, hyd | 98.97 | |
| 1tqh_A | 247 | Carboxylesterase precursor; tetrahedral intermedia | 98.97 | |
| 2psd_A | 318 | Renilla-luciferin 2-monooxygenase; alpha/beta-hydr | 98.96 | |
| 1u2e_A | 289 | 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase | 98.94 | |
| 3hju_A | 342 | Monoglyceride lipase; alpha/beta hydrolase, hydrol | 98.94 | |
| 3nwo_A | 330 | PIP, proline iminopeptidase; structural genomics, | 98.92 | |
| 3qyj_A | 291 | ALR0039 protein; alpha/beta fold, hydrolase; 1.78A | 98.92 | |
| 3i28_A | 555 | Epoxide hydrolase 2; aromatic hydrocarbons catabol | 98.91 | |
| 3hss_A | 293 | Putative bromoperoxidase; alpha beta hydrolase, ox | 98.9 | |
| 3oos_A | 278 | Alpha/beta hydrolase family protein; APC67239.0, p | 98.9 | |
| 4f0j_A | 315 | Probable hydrolytic enzyme; alpha/beta hydrolase f | 98.9 | |
| 1m33_A | 258 | BIOH protein; alpha-betta-alpha sandwich, structur | 98.89 | |
| 1isp_A | 181 | Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 | 98.89 | |
| 3g9x_A | 299 | Haloalkane dehalogenase; alpha/beta hydrolase, hel | 98.88 | |
| 3l80_A | 292 | Putative uncharacterized protein SMU.1393C; alpha/ | 98.87 | |
| 3r0v_A | 262 | Alpha/beta hydrolase fold protein; structural geno | 98.87 | |
| 1j1i_A | 296 | META cleavage compound hydrolase; carbazole degrad | 98.87 | |
| 1k8q_A | 377 | Triacylglycerol lipase, gastric; APHA beta hydrola | 98.86 | |
| 3qvm_A | 282 | OLEI00960; structural genomics, PSI-biology, midwe | 98.86 | |
| 3dkr_A | 251 | Esterase D; alpha beta hydrolase, mechanism, catal | 98.84 | |
| 3c5v_A | 316 | PME-1, protein phosphatase methylesterase 1; demet | 98.84 | |
| 2rau_A | 354 | Putative esterase; NP_343859.1, putative lipase, s | 98.83 | |
| 2dsn_A | 387 | Thermostable lipase; T1 lipase, hydrolase; 1.50A { | 98.83 | |
| 3trd_A | 208 | Alpha/beta hydrolase; cellular processes; 1.50A {C | 98.83 | |
| 1tht_A | 305 | Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. | 98.83 | |
| 2r11_A | 306 | Carboxylesterase NP; 2632844, putative hydrolase, | 98.82 | |
| 2e3j_A | 356 | Epoxide hydrolase EPHB; epoxide hydrolase B, struc | 98.81 | |
| 2q0x_A | 335 | Protein DUF1749, uncharacterized protein; alpha/be | 98.81 | |
| 2qvb_A | 297 | Haloalkane dehalogenase 3; RV2579, alpha-beta hydr | 98.8 | |
| 1ei9_A | 279 | Palmitoyl protein thioesterase 1; alpha/beta hydro | 98.8 | |
| 4dnp_A | 269 | DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu | 98.8 | |
| 2fuk_A | 220 | XC6422 protein; A/B hydrolase, structural genomics | 98.79 | |
| 2qmq_A | 286 | Protein NDRG2, protein NDR2; alpha/beta-hydrolases | 98.79 | |
| 3p2m_A | 330 | Possible hydrolase; alpha/beta hydrolase superfami | 98.78 | |
| 4g9e_A | 279 | AHL-lactonase, alpha/beta hydrolase fold protein; | 98.78 | |
| 3llc_A | 270 | Putative hydrolase; structural genomics, joint cen | 98.78 | |
| 3rm3_A | 270 | MGLP, thermostable monoacylglycerol lipase; alpha/ | 98.77 | |
| 1azw_A | 313 | Proline iminopeptidase; aminopeptidase, serine pro | 98.75 | |
| 2zyr_A | 484 | Lipase, putative; fatty acid, hydrolase; HET: 1PE; | 98.74 | |
| 1mj5_A | 302 | 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; | 98.74 | |
| 1wm1_A | 317 | Proline iminopeptidase; complex with inhibitor, hy | 98.72 | |
| 3vdx_A | 456 | Designed 16NM tetrahedral protein CAGE containing | 98.71 | |
| 3bdi_A | 207 | Uncharacterized protein TA0194; NP_393672.1, predi | 98.69 | |
| 3kxp_A | 314 | Alpha-(N-acetylaminomethylene)succinic acid hydrol | 98.69 | |
| 2i3d_A | 249 | AGR_C_3351P, hypothetical protein ATU1826; structu | 98.67 | |
| 3fla_A | 267 | RIFR; alpha-beta hydrolase thioesterase, hydrolase | 98.67 | |
| 3i1i_A | 377 | Homoserine O-acetyltransferase; structural genomic | 98.67 | |
| 3lcr_A | 319 | Tautomycetin biosynthetic PKS; alpha-beta hydrolas | 98.66 | |
| 3b12_A | 304 | Fluoroacetate dehalogenase; dehalogease, hydrolase | 98.11 | |
| 2qjw_A | 176 | Uncharacterized protein XCC1541; putative hydrolas | 98.65 | |
| 1ufo_A | 238 | Hypothetical protein TT1662; alpha-beta fold, hydr | 98.63 | |
| 4i19_A | 388 | Epoxide hydrolase; structural genomics, PSI-biolog | 98.62 | |
| 3qmv_A | 280 | Thioesterase, REDJ; alpha/beta hydrolase fold, hyd | 98.61 | |
| 1fj2_A | 232 | Protein (acyl protein thioesterase 1); alpha/beta | 98.59 | |
| 2pl5_A | 366 | Homoserine O-acetyltransferase; alpha/beta hydrola | 98.59 | |
| 2b61_A | 377 | Homoserine O-acetyltransferase; acyl-enzyme, aspar | 98.58 | |
| 2o2g_A | 223 | Dienelactone hydrolase; YP_324580.1, structural ge | 98.58 | |
| 3n2z_B | 446 | Lysosomal Pro-X carboxypeptidase; alpha/beta hydro | 98.57 | |
| 1imj_A | 210 | CIB, CCG1-interacting factor B; alpha/beta hydrola | 98.56 | |
| 2y6u_A | 398 | Peroxisomal membrane protein LPX1; hydrolase, puta | 98.55 | |
| 2pbl_A | 262 | Putative esterase/lipase/thioesterase; alpha/beta- | 98.54 | |
| 2vat_A | 444 | Acetyl-COA--deacetylcephalosporin C acetyltransfer | 98.53 | |
| 1w52_X | 452 | Pancreatic lipase related protein 2; detergent, cl | 98.52 | |
| 1auo_A | 218 | Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl | 98.51 | |
| 3e0x_A | 245 | Lipase-esterase related protein; APC60309, clostri | 98.5 | |
| 3cn9_A | 226 | Carboxylesterase; alpha/beta hydrolase fold super- | 98.5 | |
| 1jfr_A | 262 | Lipase; serine hydrolase; 1.90A {Streptomyces exfo | 98.49 | |
| 3ils_A | 265 | PKS, aflatoxin biosynthesis polyketide synthase; A | 98.49 | |
| 1bu8_A | 452 | Protein (pancreatic lipase related protein 2); hyd | 98.47 | |
| 2qs9_A | 194 | Retinoblastoma-binding protein 9; B5T overexpresse | 98.43 | |
| 2h1i_A | 226 | Carboxylesterase; structural genomics, PSI-2, prot | 98.43 | |
| 3ksr_A | 290 | Putative serine hydrolase; catalytic triad, struct | 98.42 | |
| 1vkh_A | 273 | Putative serine hydrolase; structural genomics, jo | 98.41 | |
| 1gpl_A | 432 | RP2 lipase; serine esterase, hydrolase, lipid degr | 98.41 | |
| 1zi8_A | 236 | Carboxymethylenebutenolidase; alpha and beta prote | 98.4 | |
| 3h04_A | 275 | Uncharacterized protein; protein with unknown func | 98.39 | |
| 3g02_A | 408 | Epoxide hydrolase; alpha/beta hydrolase fold, enan | 98.39 | |
| 1kez_A | 300 | Erythronolide synthase; polyketide synthase, modul | 98.39 | |
| 3og9_A | 209 | Protein YAHD A copper inducible hydrolase; alpha/b | 98.37 | |
| 1uxo_A | 192 | YDEN protein; hydrolase, A/B hydrolase, esterase, | 98.36 | |
| 2r8b_A | 251 | AGR_C_4453P, uncharacterized protein ATU2452; APC6 | 98.35 | |
| 3b5e_A | 223 | MLL8374 protein; NP_108484.1, carboxylesterase, st | 98.34 | |
| 3hxk_A | 276 | Sugar hydrolase; alpha-beta protein., structural g | 98.32 | |
| 3f67_A | 241 | Putative dienelactone hydrolase; alpha-beta-alpha | 98.32 | |
| 3bxp_A | 277 | Putative lipase/esterase; putative carboxylesteras | 98.3 | |
| 1qlw_A | 328 | Esterase; anisotropic refinement, atomic resolutio | 98.3 | |
| 3d7r_A | 326 | Esterase; alpha/beta fold, hydrolase; 2.01A {Staph | 98.29 | |
| 1hpl_A | 449 | Lipase; hydrolase(carboxylic esterase); 2.30A {Equ | 98.28 | |
| 3bdv_A | 191 | Uncharacterized protein DUF1234; DUF1234 family pr | 98.27 | |
| 3bjr_A | 283 | Putative carboxylesterase; structural genomics, jo | 98.25 | |
| 2hdw_A | 367 | Hypothetical protein PA2218; alpha/beta hydrolase | 98.25 | |
| 2hfk_A | 319 | Pikromycin, type I polyketide synthase pikaiv; alp | 98.22 | |
| 2k2q_B | 242 | Surfactin synthetase thioesterase subunit; A/B-hyd | 98.21 | |
| 3vis_A | 306 | Esterase; alpha/beta-hydrolase fold, polyethylene | 98.2 | |
| 3u0v_A | 239 | Lysophospholipase-like protein 1; alpha, beta hydr | 98.2 | |
| 3tej_A | 329 | Enterobactin synthase component F; nonribosomal pe | 98.19 | |
| 2c7b_A | 311 | Carboxylesterase, ESTE1; carboxyesterase, thermoph | 98.19 | |
| 2o7r_A | 338 | CXE carboxylesterase; alpha/beta hydrolase; 1.40A | 98.16 | |
| 3d0k_A | 304 | Putative poly(3-hydroxybutyrate) depolymerase LPQ; | 98.12 | |
| 3k2i_A | 422 | Acyl-coenzyme A thioesterase 4; alpha/beta hydrola | 98.12 | |
| 3o4h_A | 582 | Acylamino-acid-releasing enzyme; alpha/beta hydrol | 98.12 | |
| 2hm7_A | 310 | Carboxylesterase; alpha/beta hydrolase fold, hydro | 98.11 | |
| 4e15_A | 303 | Kynurenine formamidase; alpha/beta hydrolase fold, | 98.1 | |
| 4fle_A | 202 | Esterase; structural genomics, PSI-biology, northe | 98.09 | |
| 3ain_A | 323 | 303AA long hypothetical esterase; carboxylesterase | 98.08 | |
| 2dst_A | 131 | Hypothetical protein TTHA1544; conserved hypotheti | 98.07 | |
| 2wir_A | 313 | Pesta, alpha/beta hydrolase fold-3 domain protein; | 98.07 | |
| 1rp1_A | 450 | Pancreatic lipase related protein 1; hydrolase, li | 98.07 | |
| 1l7a_A | 318 | Cephalosporin C deacetylase; structural genomics, | 98.06 | |
| 2zsh_A | 351 | Probable gibberellin receptor GID1L1; plant hormon | 98.05 | |
| 3hlk_A | 446 | Acyl-coenzyme A thioesterase 2, mitochondrial; alp | 98.05 | |
| 3mve_A | 415 | FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ | 98.04 | |
| 3e4d_A | 278 | Esterase D; S-formylglutathione hydrolase, hydrola | 98.03 | |
| 2qru_A | 274 | Uncharacterized protein; alpha/beta-hydrolase, str | 98.01 | |
| 3k6k_A | 322 | Esterase/lipase; alpha/beta hydrolase fold; 2.20A | 98.01 | |
| 2jbw_A | 386 | Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine | 98.0 | |
| 1jkm_A | 361 | Brefeldin A esterase; serine hydrolase, degradatio | 97.95 | |
| 1jji_A | 311 | Carboxylesterase; alpha-beta hydrolase fold, hydro | 97.94 | |
| 1lzl_A | 323 | Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod | 97.92 | |
| 4h0c_A | 210 | Phospholipase/carboxylesterase; PSI-biology, midwe | 97.91 | |
| 3fcy_A | 346 | Xylan esterase 1; alpha/beta hydrolase, carbohydra | 97.9 | |
| 3h2g_A | 397 | Esterase; xanthomonas oryzae PV. oryzae, cell WALL | 97.9 | |
| 1vlq_A | 337 | Acetyl xylan esterase; TM0077, structural genomics | 97.9 | |
| 3azo_A | 662 | Aminopeptidase; POP family, hydrolase; 2.00A {Stre | 97.88 | |
| 2z3z_A | 706 | Dipeptidyl aminopeptidase IV; peptidase family S9, | 97.87 | |
| 2ecf_A | 741 | Dipeptidyl peptidase IV; prolyl oligopeptidase fam | 97.87 | |
| 1jjf_A | 268 | Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x | 97.85 | |
| 1dqz_A | 280 | 85C, protein (antigen 85-C); fibronectin, structur | 97.84 | |
| 2cb9_A | 244 | Fengycin synthetase; thioesterase, non-ribosomal p | 97.84 | |
| 3fnb_A | 405 | Acylaminoacyl peptidase SMU_737; alpha-beta-alpha | 97.84 | |
| 3fak_A | 322 | Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc | 97.84 | |
| 3tjm_A | 283 | Fatty acid synthase; thioesterase domain, fatty ac | 97.83 | |
| 2uz0_A | 263 | Esterase, tributyrin esterase; alpha/beta hydrolas | 97.82 | |
| 4ezi_A | 377 | Uncharacterized protein; alpha-beta hydrolases fol | 97.8 | |
| 3i6y_A | 280 | Esterase APC40077; lipase, structural genomics, PS | 97.79 | |
| 2fx5_A | 258 | Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse | 97.77 | |
| 4b6g_A | 283 | Putative esterase; hydrolase, formaldehyde detoxif | 97.74 | |
| 1jmk_C | 230 | SRFTE, surfactin synthetase; thioesterase, non-rib | 97.74 | |
| 3g8y_A | 391 | SUSD/RAGB-associated esterase-like protein; struct | 97.72 | |
| 3fcx_A | 282 | FGH, esterase D, S-formylglutathione hydrolase; re | 97.7 | |
| 3ga7_A | 326 | Acetyl esterase; phosphoserine, IDP00896, hydrolas | 97.7 | |
| 3d59_A | 383 | Platelet-activating factor acetylhydrolase; secret | 97.67 | |
| 1sfr_A | 304 | Antigen 85-A; alpha/beta hydrolase, structural gen | 97.67 | |
| 1tib_A | 269 | Lipase; hydrolase(carboxylic esterase); 1.84A {The | 97.66 | |
| 2bkl_A | 695 | Prolyl endopeptidase; mechanistic study, celiac sp | 97.66 | |
| 3ls2_A | 280 | S-formylglutathione hydrolase; psychrophilic organ | 97.64 | |
| 3i2k_A | 587 | Cocaine esterase; alpha/beta hydrolase, hydrolase; | 97.63 | |
| 1lgy_A | 269 | Lipase, triacylglycerol lipase; hydrolase (carboxy | 97.62 | |
| 1r88_A | 280 | MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP | 97.62 | |
| 1mpx_A | 615 | Alpha-amino acid ester hydrolase; alpha/beta hydro | 97.6 | |
| 4ao6_A | 259 | Esterase; hydrolase, thermo label; 1.60A {Unidenti | 97.59 | |
| 1yr2_A | 741 | Prolyl oligopeptidase; prolyl endopeptidase, mecha | 97.59 | |
| 1xfd_A | 723 | DIP, dipeptidyl aminopeptidase-like protein 6, dip | 97.59 | |
| 1lns_A | 763 | X-prolyl dipeptidyl aminopetidase; alpha beta hydr | 97.54 | |
| 3iii_A | 560 | COCE/NOND family hydrolase; structural genomics, c | 97.53 | |
| 3iuj_A | 693 | Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas | 97.5 | |
| 3nuz_A | 398 | Putative acetyl xylan esterase; structural genomic | 97.49 | |
| 3ebl_A | 365 | Gibberellin receptor GID1; alpha/beta hydrolase, l | 97.48 | |
| 1z68_A | 719 | Fibroblast activation protein, alpha subunit; sepr | 97.46 | |
| 2xdw_A | 710 | Prolyl endopeptidase; alpha/beta-hydrolase, amnesi | 97.45 | |
| 1tgl_A | 269 | Triacyl-glycerol acylhydrolase; carboxylic esteras | 97.42 | |
| 1gkl_A | 297 | Endo-1,4-beta-xylanase Y; hydrolase, esterase fami | 97.42 | |
| 3qh4_A | 317 | Esterase LIPW; structural genomics, ssgcid, seattl | 97.4 | |
| 1tia_A | 279 | Lipase; hydrolase(carboxylic esterase); 2.10A {Pen | 97.39 | |
| 1ycd_A | 243 | Hypothetical 27.3 kDa protein in AAP1-SMF2 interge | 97.38 | |
| 2xe4_A | 751 | Oligopeptidase B; hydrolase-inhibitor complex, hyd | 97.35 | |
| 2b9v_A | 652 | Alpha-amino acid ester hydrolase; catalytic triad, | 97.3 | |
| 3doh_A | 380 | Esterase; alpha-beta hydrolase, beta sheet; 2.60A | 97.29 | |
| 1uwc_A | 261 | Feruloyl esterase A; hydrolase, serine esterase, x | 97.28 | |
| 3guu_A | 462 | Lipase A; protein structure, hydrolase; HET: 1PE; | 97.27 | |
| 4a5s_A | 740 | Dipeptidyl peptidase 4 soluble form; hydrolase, ty | 97.24 | |
| 3g7n_A | 258 | Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A | 97.14 | |
| 3uue_A | 279 | LIP1, secretory lipase (family 3); LID-domain, hyd | 97.13 | |
| 2px6_A | 316 | Thioesterase domain; thioesaterse domain, orlistat | 96.94 | |
| 4hvt_A | 711 | Ritya.17583.B, post-proline cleaving enzyme; ssgci | 96.88 | |
| 3c8d_A | 403 | Enterochelin esterase; alpha-beta-alpha sandwich, | 96.88 | |
| 3ngm_A | 319 | Extracellular lipase; secret lipase, hydrolase; 2. | 96.84 | |
| 3o0d_A | 301 | YALI0A20350P, triacylglycerol lipase; alpha/beta-h | 96.82 | |
| 4fhz_A | 285 | Phospholipase/carboxylesterase; alpha/beta hydrola | 96.74 | |
| 2qm0_A | 275 | BES; alpha-beta structure, structural genomics, PS | 96.44 | |
| 3qpa_A | 197 | Cutinase; alpha-beta hydrolase fold, esterase, hyd | 96.05 | |
| 1g66_A | 207 | Acetyl xylan esterase II; serine hydrolase, acetyl | 95.87 | |
| 1qoz_A | 207 | AXE, acetyl xylan esterase; hydrolase, xylan degra | 95.83 | |
| 3gff_A | 331 | IROE-like serine hydrolase; NP_718593.1, structura | 95.8 | |
| 4f21_A | 246 | Carboxylesterase/phospholipase family protein; str | 95.55 | |
| 3dcn_A | 201 | Cutinase, cutin hydrolase; catalytic triad, secret | 95.53 | |
| 2gzs_A | 278 | IROE protein; enterobactin, salmochelin, DFP, hydr | 95.49 | |
| 3qpd_A | 187 | Cutinase 1; alpha-beta hydrolase fold, esterase, h | 95.38 | |
| 2czq_A | 205 | Cutinase-like protein; alpha/beta hydrolase fold, | 95.25 | |
| 3hc7_A | 254 | Gene 12 protein, GP12; alpha/beta sandwich, cell a | 95.21 | |
| 2ory_A | 346 | Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Ph | 94.57 | |
| 2ogt_A | 498 | Thermostable carboxylesterase EST50; alpha/beta hy | 92.53 | |
| 2yij_A | 419 | Phospholipase A1-iigamma; hydrolase; 2.00A {Arabid | 91.5 | |
| 3aja_A | 302 | Putative uncharacterized protein; alpha-beta hydro | 92.18 | |
| 1qe3_A | 489 | PNB esterase, para-nitrobenzyl esterase; alpha-bet | 91.52 | |
| 2d81_A | 318 | PHB depolymerase; alpha/beta hydrolase fold, circu | 91.23 | |
| 4fol_A | 299 | FGH, S-formylglutathione hydrolase; D-type esteras | 89.29 | |
| 3pic_A | 375 | CIP2; alpha/beta hydrolase fold, glucuronoyl ester | 87.54 | |
| 4g4g_A | 433 | 4-O-methyl-glucuronoyl methylesterase; alpha/beta | 87.29 | |
| 4ebb_A | 472 | Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2 | 86.49 | |
| 2fj0_A | 551 | JuvenIle hormone esterase; manduca sexta, alpha-be | 85.83 | |
| 1ivy_A | 452 | Human protective protein; carboxypeptidase, serine | 83.82 | |
| 2h7c_A | 542 | Liver carboxylesterase 1; enzyme, cholesteryl este | 82.93 | |
| 1p0i_A | 529 | Cholinesterase; serine hydrolase, butyrate, hydrol | 82.09 | |
| 2ha2_A | 543 | ACHE, acetylcholinesterase; hydrolase fold, serine | 81.74 | |
| 1ea5_A | 537 | ACHE, acetylcholinesterase; hydrolase, serine hydr | 80.27 | |
| 2vsq_A | 1304 | Surfactin synthetase subunit 3; ligase, peptidyl c | 80.25 |
| >3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
Probab=99.51 E-value=2.5e-13 Score=129.71 Aligned_cols=97 Identities=15% Similarity=0.141 Sum_probs=74.5
Q ss_pred hhHHHHHHHHHHCCC--ee-ecCcccCCCC-----C---------------CCCchHHHHHHHHHHHHHHHHHHhCCCcE
Q 013182 112 YHFHDMIEMLVKCGY--KK-GTTLFGYGYD-----F---------------RQSNRIDKLMEGLKVKLETAYKASGNRKV 168 (448)
Q Consensus 112 ~~~~~l~~~L~~~Gy--~v-~~dl~g~~yd-----~---------------r~~~~~~~~~~~L~~~Ie~~~~~~~~~kv 168 (448)
..|..+++.|.+.|| ++ ..|+.++|-. + .........++.+.+.++.+.++.+.+++
T Consensus 20 ~~~~~l~~~L~~~g~~~~vi~~dv~~~G~~~~~G~~~~~~~~P~i~v~f~~n~~~~~~~~~~~l~~~i~~l~~~~~~~~~ 99 (249)
T 3fle_A 20 RSETFMVKQALNKNVTNEVITARVSSEGKVYFDKKLSEDAANPIVKVEFKDNKNGNFKENAYWIKEVLSQLKSQFGIQQF 99 (249)
T ss_dssp GGTHHHHHHHHTTTSCSCEEEEEECSSCCEEESSCCC--CCSCEEEEEESSTTCCCHHHHHHHHHHHHHHHHHTTCCCEE
T ss_pred hHHHHHHHHHHHcCCCceEEEEEECCCCCEEEccccccccCCCeEEEEcCCCCCccHHHHHHHHHHHHHHHHHHhCCCce
Confidence 468999999999997 34 5566555431 1 01113445678899999999887777899
Q ss_pred EEEEeChhHHHHHHHHHhcCcccc-ccccEEEEEcCCCCCC
Q 013182 169 TLITHSMGGLLVMCFMSLHKDVFS-KFVNKWITIASPFQGA 208 (448)
Q Consensus 169 ~LVGHSMGGlva~~~l~~~~~~~~-~~V~~~I~i~~P~~Gs 208 (448)
+||||||||+++++|+..+|+..+ .+|+++|+|++|+.|+
T Consensus 100 ~lvGHSmGG~ia~~~~~~~~~~~~~~~v~~lv~i~~p~~g~ 140 (249)
T 3fle_A 100 NFVGHSMGNMSFAFYMKNYGDDRHLPQLKKEVNIAGVYNGI 140 (249)
T ss_dssp EEEEETHHHHHHHHHHHHHSSCSSSCEEEEEEEESCCTTCC
T ss_pred EEEEECccHHHHHHHHHHCcccccccccceEEEeCCccCCc
Confidence 999999999999999998875221 4799999999999887
|
| >1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 | Back alignment and structure |
|---|
| >3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} | Back alignment and structure |
|---|
| >3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* | Back alignment and structure |
|---|
| >2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* | Back alignment and structure |
|---|
| >1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A | Back alignment and structure |
|---|
| >2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* | Back alignment and structure |
|---|
| >3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... | Back alignment and structure |
|---|
| >3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 | Back alignment and structure |
|---|
| >2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} | Back alignment and structure |
|---|
| >1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 | Back alignment and structure |
|---|
| >1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* | Back alignment and structure |
|---|
| >1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 | Back alignment and structure |
|---|
| >1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A | Back alignment and structure |
|---|
| >1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 | Back alignment and structure |
|---|
| >1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A | Back alignment and structure |
|---|
| >1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* | Back alignment and structure |
|---|
| >2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* | Back alignment and structure |
|---|
| >3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A | Back alignment and structure |
|---|
| >4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A | Back alignment and structure |
|---|
| >2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* | Back alignment and structure |
|---|
| >2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A | Back alignment and structure |
|---|
| >2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus} | Back alignment and structure |
|---|
| >3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* | Back alignment and structure |
|---|
| >2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A | Back alignment and structure |
|---|
| >1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E | Back alignment and structure |
|---|
| >3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* | Back alignment and structure |
|---|
| >3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} | Back alignment and structure |
|---|
| >3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* | Back alignment and structure |
|---|
| >1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* | Back alignment and structure |
|---|
| >2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A | Back alignment and structure |
|---|
| >1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A | Back alignment and structure |
|---|
| >3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 | Back alignment and structure |
|---|
| >3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A | Back alignment and structure |
|---|
| >2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A | Back alignment and structure |
|---|
| >1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 | Back alignment and structure |
|---|
| >2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* | Back alignment and structure |
|---|
| >3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} | Back alignment and structure |
|---|
| >3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} | Back alignment and structure |
|---|
| >1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A | Back alignment and structure |
|---|
| >3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A | Back alignment and structure |
|---|
| >3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A | Back alignment and structure |
|---|
| >3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} | Back alignment and structure |
|---|
| >1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* | Back alignment and structure |
|---|
| >1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 | Back alignment and structure |
|---|
| >3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* | Back alignment and structure |
|---|
| >1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A | Back alignment and structure |
|---|
| >2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A | Back alignment and structure |
|---|
| >1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} | Back alignment and structure |
|---|
| >3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} | Back alignment and structure |
|---|
| >3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* | Back alignment and structure |
|---|
| >3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A | Back alignment and structure |
|---|
| >3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} | Back alignment and structure |
|---|
| >4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 | Back alignment and structure |
|---|
| >1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A | Back alignment and structure |
|---|
| >3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A | Back alignment and structure |
|---|
| >3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 | Back alignment and structure |
|---|
| >1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* | Back alignment and structure |
|---|
| >3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} | Back alignment and structure |
|---|
| >3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A | Back alignment and structure |
|---|
| >3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P | Back alignment and structure |
|---|
| >2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >2dsn_A Thermostable lipase; T1 lipase, hydrolase; 1.50A {Geobacillus zalihae} PDB: 3umj_A 2z5g_A 1ji3_A 3auk_A 2w22_A* 1ku0_A | Back alignment and structure |
|---|
| >3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 | Back alignment and structure |
|---|
| >2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* | Back alignment and structure |
|---|
| >2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A | Back alignment and structure |
|---|
| >1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A | Back alignment and structure |
|---|
| >4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A | Back alignment and structure |
|---|
| >2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 | Back alignment and structure |
|---|
| >2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A | Back alignment and structure |
|---|
| >3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A | Back alignment and structure |
|---|
| >3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} | Back alignment and structure |
|---|
| >3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A | Back alignment and structure |
|---|
| >1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 | Back alignment and structure |
|---|
| >2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* | Back alignment and structure |
|---|
| >1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A | Back alignment and structure |
|---|
| >1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* | Back alignment and structure |
|---|
| >3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A | Back alignment and structure |
|---|
| >3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} | Back alignment and structure |
|---|
| >3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 | Back alignment and structure |
|---|
| >3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* | Back alignment and structure |
|---|
| >3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} | Back alignment and structure |
|---|
| >3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A | Back alignment and structure |
|---|
| >2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 | Back alignment and structure |
|---|
| >4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} | Back alignment and structure |
|---|
| >3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* | Back alignment and structure |
|---|
| >1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 | Back alignment and structure |
|---|
| >2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 | Back alignment and structure |
|---|
| >2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} | Back alignment and structure |
|---|
| >3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} | Back alignment and structure |
|---|
| >1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 | Back alignment and structure |
|---|
| >2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* | Back alignment and structure |
|---|
| >2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 | Back alignment and structure |
|---|
| >2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* | Back alignment and structure |
|---|
| >1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} | Back alignment and structure |
|---|
| >1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* | Back alignment and structure |
|---|
| >3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* | Back alignment and structure |
|---|
| >1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 | Back alignment and structure |
|---|
| >3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} | Back alignment and structure |
|---|
| >1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* | Back alignment and structure |
|---|
| >2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 | Back alignment and structure |
|---|
| >1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A | Back alignment and structure |
|---|
| >1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* | Back alignment and structure |
|---|
| >3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* | Back alignment and structure |
|---|
| >1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A | Back alignment and structure |
|---|
| >3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 | Back alignment and structure |
|---|
| >2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* | Back alignment and structure |
|---|
| >1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* | Back alignment and structure |
|---|
| >3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 | Back alignment and structure |
|---|
| >3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} | Back alignment and structure |
|---|
| >3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A | Back alignment and structure |
|---|
| >2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A | Back alignment and structure |
|---|
| >3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} | Back alignment and structure |
|---|
| >3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A | Back alignment and structure |
|---|
| >2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} | Back alignment and structure |
|---|
| >2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A | Back alignment and structure |
|---|
| >3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} | Back alignment and structure |
|---|
| >3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A | Back alignment and structure |
|---|
| >2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A | Back alignment and structure |
|---|
| >4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A | Back alignment and structure |
|---|
| >4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} | Back alignment and structure |
|---|
| >3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A | Back alignment and structure |
|---|
| >2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 | Back alignment and structure |
|---|
| >1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A | Back alignment and structure |
|---|
| >1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* | Back alignment and structure |
|---|
| >2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* | Back alignment and structure |
|---|
| >3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A | Back alignment and structure |
|---|
| >3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A | Back alignment and structure |
|---|
| >2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 | Back alignment and structure |
|---|
| >1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 | Back alignment and structure |
|---|
| >1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 | Back alignment and structure |
|---|
| >1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A | Back alignment and structure |
|---|
| >4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} | Back alignment and structure |
|---|
| >3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} | Back alignment and structure |
|---|
| >3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A | Back alignment and structure |
|---|
| >1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* | Back alignment and structure |
|---|
| >3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A | Back alignment and structure |
|---|
| >2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* | Back alignment and structure |
|---|
| >2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* | Back alignment and structure |
|---|
| >1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* | Back alignment and structure |
|---|
| >2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* | Back alignment and structure |
|---|
| >3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A | Back alignment and structure |
|---|
| >3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A | Back alignment and structure |
|---|
| >2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A | Back alignment and structure |
|---|
| >2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} | Back alignment and structure |
|---|
| >4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 | Back alignment and structure |
|---|
| >3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} | Back alignment and structure |
|---|
| >3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* | Back alignment and structure |
|---|
| >1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 | Back alignment and structure |
|---|
| >1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* | Back alignment and structure |
|---|
| >2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >3i2k_A Cocaine esterase; alpha/beta hydrolase, hydrolase; HET: DBC GOL; 1.51A {Rhodococcus SP} PDB: 3i2j_A* 3puh_A 3i2h_A* 3i2i_A* 3i2g_A* 3ida_A* 3i2f_A* 3pui_A 1ju3_A 1ju4_A 1l7q_A 1l7r_A | Back alignment and structure |
|---|
| >1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A | Back alignment and structure |
|---|
| >1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 | Back alignment and structure |
|---|
| >1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 | Back alignment and structure |
|---|
| >4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A | Back alignment and structure |
|---|
| >1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} | Back alignment and structure |
|---|
| >1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 | Back alignment and structure |
|---|
| >1lns_A X-prolyl dipeptidyl aminopetidase; alpha beta hydrolase fold; 2.20A {Lactococcus lactis} SCOP: a.40.2.1 b.18.1.13 c.69.1.21 | Back alignment and structure |
|---|
| >3iii_A COCE/NOND family hydrolase; structural genomics, center for structural genomi infectious diseases, csgid; HET: MSE PLM; 1.95A {Staphylococcus aureus subsp} PDB: 3ib3_A* | Back alignment and structure |
|---|
| >3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* | Back alignment and structure |
|---|
| >3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* | Back alignment and structure |
|---|
| >1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* | Back alignment and structure |
|---|
| >1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A | Back alignment and structure |
|---|
| >1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* | Back alignment and structure |
|---|
| >3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 | Back alignment and structure |
|---|
| >1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} | Back alignment and structure |
|---|
| >2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A | Back alignment and structure |
|---|
| >3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A | Back alignment and structure |
|---|
| >1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* | Back alignment and structure |
|---|
| >3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* | Back alignment and structure |
|---|
| >4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... | Back alignment and structure |
|---|
| >3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum} | Back alignment and structure |
|---|
| >3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A* | Back alignment and structure |
|---|
| >2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} | Back alignment and structure |
|---|
| >3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* | Back alignment and structure |
|---|
| >3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae} | Back alignment and structure |
|---|
| >3o0d_A YALI0A20350P, triacylglycerol lipase; alpha/beta-hydrolase, lipids binding, glycosylation, extracellular, hydrolase; HET: NAG; 1.70A {Yarrowia lipolytica} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* | Back alignment and structure |
|---|
| >2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} | Back alignment and structure |
|---|
| >3qpa_A Cutinase; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted; HET: MIR; 0.85A {Nectria haematococca} PDB: 3qpc_A* 1cex_A 1oxm_A* 1cui_A 1cus_A 2cut_A 1cuj_A 1cuy_A 1xzl_A* 1xzk_A* 1xzm_A* 1cuh_A 1cuu_A 3esc_A* 1cua_A* 3esa_A* 3esb_A* 3ef3_A* 3esd_A* 1cux_A ... | Back alignment and structure |
|---|
| >1g66_A Acetyl xylan esterase II; serine hydrolase, acetyl xylopyranose, hydrolase; 0.90A {Penicillium purpurogenum} SCOP: c.69.1.30 PDB: 1bs9_A 2axe_A* | Back alignment and structure |
|---|
| >1qoz_A AXE, acetyl xylan esterase; hydrolase, xylan degradation; HET: NAG; 1.90A {Trichoderma reesei} SCOP: c.69.1.30 | Back alignment and structure |
|---|
| >3gff_A IROE-like serine hydrolase; NP_718593.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.12A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >3dcn_A Cutinase, cutin hydrolase; catalytic triad, secreted, serine esterase; 1.90A {Glomerella cingulata} SCOP: c.69.1.0 PDB: 3dd5_A 3dea_A* | Back alignment and structure |
|---|
| >2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A* | Back alignment and structure |
|---|
| >3qpd_A Cutinase 1; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted, phosphorylated Ser residue; HET: SEP; 1.57A {Aspergillus oryzae} PDB: 3gbs_A | Back alignment and structure |
|---|
| >2czq_A Cutinase-like protein; alpha/beta hydrolase fold, hydrolase; HET: CIT; 1.05A {Cryptococcus SP} | Back alignment and structure |
|---|
| >3hc7_A Gene 12 protein, GP12; alpha/beta sandwich, cell adhesion; 2.00A {Mycobacterium phage D29} | Back alignment and structure |
|---|
| >2ory_A Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Photobacterium SP} | Back alignment and structure |
|---|
| >2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A | Back alignment and structure |
|---|
| >2yij_A Phospholipase A1-iigamma; hydrolase; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3aja_A Putative uncharacterized protein; alpha-beta hydrolase, serine esterase, cutinase, lipase, HYD; 2.90A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A | Back alignment and structure |
|---|
| >2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A* | Back alignment and structure |
|---|
| >4fol_A FGH, S-formylglutathione hydrolase; D-type esterase, oxidation sensor motif, esterase activity activation, esterase activity inhibition; 2.07A {Saccharomyces cerevisiae} PDB: 1pv1_A 3c6b_A* 4flm_A* | Back alignment and structure |
|---|
| >3pic_A CIP2; alpha/beta hydrolase fold, glucuronoyl esterase, carbohydrat esterase family 15 (CE-15), N-linked glycosylation, secrete hydrolase; HET: NAG; 1.90A {Hypocrea jecorina} | Back alignment and structure |
|---|
| >4g4g_A 4-O-methyl-glucuronoyl methylesterase; alpha/beta hydrolase, 3-layer alpha/beta/alpha sandwich, ROS fold, glucuronoyl esterase; 1.55A {Myceliophthora thermophila} PDB: 4g4i_A 4g4j_A* | Back alignment and structure |
|---|
| >4ebb_A Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2.00A {Homo sapiens} PDB: 3jyh_A* 3n0t_A* | Back alignment and structure |
|---|
| >2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} | Back alignment and structure |
|---|
| >1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 | Back alignment and structure |
|---|
| >2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* | Back alignment and structure |
|---|
| >1p0i_A Cholinesterase; serine hydrolase, butyrate, hydrolase; HET: NAG FUC MES; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 1p0m_A* 1p0p_A* 1p0q_A* 1xlu_A* 1xlv_A* 1xlw_A* 2wsl_A* 2pm8_A* 3djy_A* 3dkk_A* 2wij_A* 2wif_A* 2wik_A* 2y1k_A* 2j4c_A* 2xmb_A* 2xmc_A* 2xmd_A* 2xmg_A* 2wig_A* ... | Back alignment and structure |
|---|
| >2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... | Back alignment and structure |
|---|
| >1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ... | Back alignment and structure |
|---|
| >2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 448 | ||||
| d1ex9a_ | 285 | c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [Tax | 9e-09 | |
| d1tcaa_ | 317 | c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Cand | 1e-08 | |
| d1cvla_ | 319 | c.69.1.18 (A:) Lipase {Chromobacterium viscosum [T | 8e-07 | |
| d1ispa_ | 179 | c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: | 3e-04 |
| >d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Length = 285 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: alpha/beta-Hydrolases superfamily: alpha/beta-Hydrolases family: Bacterial lipase domain: Lipase species: Pseudomonas aeruginosa [TaxId: 287]
Score = 54.0 bits (129), Expect = 9e-09
Identities = 23/112 (20%), Positives = 43/112 (38%), Gaps = 17/112 (15%)
Query: 105 LIH-------FTEVYHFHDMIEMLVKCGYKKGTTLFGYGYDFRQSNRIDKLMEGLKVKLE 157
L H V ++ + L + G + Y + Q + + E L ++E
Sbjct: 12 LAHGMLGFDNILGVDYWFGIPSALRRDGAQ------VYVTEVSQLDTSEVRGEQLLQQVE 65
Query: 158 TAYKASGNRKVTLITHSMGGLLVMCFMSLHKDVFSKFVNKWITIASPFQGAP 209
SG KV LI HS GG + ++ D+ + ++ +P +G+
Sbjct: 66 EIVALSGQPKVNLIGHSHGGPTIRYVAAVRPDLIASAT----SVGAPHKGSD 113
|
| >d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Length = 317 | Back information, alignment and structure |
|---|
| >d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Length = 319 | Back information, alignment and structure |
|---|
| >d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Length = 179 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 448 | |||
| d1ex9a_ | 285 | Lipase {Pseudomonas aeruginosa [TaxId: 287]} | 99.37 | |
| d1tcaa_ | 317 | Triacylglycerol lipase {Yeast (Candida antarctica) | 99.36 | |
| d1ispa_ | 179 | Lipase A {Bacillus subtilis [TaxId: 1423]} | 99.33 | |
| d1cvla_ | 319 | Lipase {Chromobacterium viscosum [TaxId: 42739]} | 99.33 | |
| d1zd3a2 | 322 | Mammalian epoxide hydrolase, C-terminal domain {Hu | 99.25 | |
| d1pjaa_ | 268 | Palmitoyl protein thioesterase 2 {Human (Homo sapi | 99.22 | |
| d3c70a1 | 256 | Hydroxynitrile lyase {Rubber tree (Hevea brasilien | 99.21 | |
| d1brta_ | 277 | Bromoperoxidase A2 {Streptomyces aureofaciens [Tax | 99.17 | |
| d1b6ga_ | 310 | Haloalkane dehalogenase {Xanthobacter autotrophicu | 99.16 | |
| d1a8qa_ | 274 | Bromoperoxidase A1 {Streptomyces aureofaciens [Tax | 99.11 | |
| d1hkha_ | 279 | Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] | 99.1 | |
| d1ehya_ | 293 | Bacterial epoxide hydrolase {Agrobacterium radioba | 99.1 | |
| d1mtza_ | 290 | Tricorn interacting factor F1 {Archaeon Thermoplas | 99.08 | |
| d1uk8a_ | 271 | Meta-cleavage product hydrolase CumD {Pseudomonas | 99.08 | |
| d1q0ra_ | 297 | Aclacinomycin methylesterase RdmC {Streptomyces pu | 99.05 | |
| d1xkla_ | 258 | Salicylic acid-binding protein 2 (SABP2) {Common t | 99.04 | |
| d1j1ia_ | 268 | Meta cleavage compound hydrolase CarC {Janthinobac | 99.03 | |
| d1c4xa_ | 281 | 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas | 98.99 | |
| d1bn7a_ | 291 | Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 | 98.99 | |
| d2rhwa1 | 283 | 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas | 98.97 | |
| d1a88a_ | 275 | Chloroperoxidase L {Streptomyces lividans [TaxId: | 98.97 | |
| d1va4a_ | 271 | Arylesterase {Pseudomonas fluorescens [TaxId: 294] | 98.88 | |
| d1imja_ | 208 | Ccg1/TafII250-interacting factor B (Cib) {Human (H | 98.88 | |
| d1a8sa_ | 273 | Chloroperoxidase F {Pseudomonas fluorescens [TaxId | 98.88 | |
| d1k8qa_ | 377 | Gastric lipase {Dog (Canis familiaris) [TaxId: 961 | 98.87 | |
| d1ku0a_ | 388 | Lipase L1 {Bacillus stearothermophilus [TaxId: 142 | 98.86 | |
| d1mj5a_ | 298 | Haloalkane dehalogenase {Sphingomonas paucimobilis | 98.81 | |
| d1ei9a_ | 279 | Palmitoyl protein thioesterase 1 {Cow (Bos taurus) | 98.8 | |
| d1r3da_ | 264 | Hypothetical protein VC1974 {Vibrio cholerae [TaxI | 98.79 | |
| d2fuka1 | 218 | XC6422 protein {Xanthomonas campestris [TaxId: 339 | 98.72 | |
| d1thta_ | 302 | Myristoyl-ACP-specific thioesterase {Vibrio harvey | 98.72 | |
| d1m33a_ | 256 | Biotin biosynthesis protein BioH {Escherichia coli | 98.67 | |
| d1tqha_ | 242 | Carboxylesterase Est {Bacillus stearothermophilus | 98.65 | |
| d1azwa_ | 313 | Proline iminopeptidase {Xanthomonas campestris, pv | 98.59 | |
| d1uxoa_ | 186 | Hypothetical protein YdeN {Bacillus subtilis [TaxI | 98.46 | |
| d1wm1a_ | 313 | Proline aminopeptidase {Serratia marcescens [TaxId | 98.43 | |
| d2h7xa1 | 283 | Picromycin polyketide synthase {Streptomyces venez | 98.43 | |
| d1xkta_ | 286 | Fatty acid synthase {Human (Homo sapiens) [TaxId: | 98.36 | |
| d2dsta1 | 122 | Hypothetical protein TTHA1544 {Thermus thermophilu | 98.25 | |
| d1mo2a_ | 255 | Erythromycin polyketide synthase {Saccharopolyspor | 98.22 | |
| d2jbwa1 | 360 | 2,6-dihydropseudooxynicotine hydrolase {Arthrobact | 98.13 | |
| d1qo7a_ | 394 | Bacterial epoxide hydrolase {Aspergillus niger [Ta | 98.11 | |
| d1jmkc_ | 230 | Surfactin synthetase, SrfA {Bacillus subtilis [Tax | 98.1 | |
| d1ufoa_ | 238 | Hypothetical protein TT1662 {Thermus thermophilus | 97.76 | |
| d1jfra_ | 260 | Lipase {Streptomyces exfoliatus [TaxId: 1905]} | 97.47 | |
| d3b5ea1 | 209 | Uncharacterized protein Mll8374 {Mesorhizobium lot | 97.29 | |
| d2vata1 | 376 | Acetyl-CoA:deacetylcephalosporin C acetyltransfera | 97.27 | |
| d1fj2a_ | 229 | Acyl protein thioesterase 1 {Human (Homo sapiens) | 97.26 | |
| d2hu7a2 | 260 | Acylamino-acid-releasing enzyme, C-terminal donain | 97.22 | |
| d1vkha_ | 263 | Putative serine hydrolase Ydr428c {Baker's yeast ( | 97.19 | |
| d2pl5a1 | 362 | Homoserine O-acetyltransferase {Leptospira interro | 97.17 | |
| d2i3da1 | 218 | Hypothetical protein Atu1826 {Agrobacterium tumefa | 97.07 | |
| d2r8ba1 | 203 | Uncharacterized protein Atu2452 {Agrobacterium tum | 97.02 | |
| d1lgya_ | 265 | Triacylglycerol lipase {Rhizopus niveus [TaxId: 48 | 96.91 | |
| d2pbla1 | 261 | Uncharacterized protein TM1040_2492 {Silicibacter | 96.9 | |
| d1tiaa_ | 271 | Triacylglycerol lipase {Penicillium camembertii [T | 96.9 | |
| d1tiba_ | 269 | Triacylglycerol lipase {Thermomyces lanuginosus, f | 96.86 | |
| d2b61a1 | 357 | Homoserine O-acetyltransferase {Haemophilus influe | 96.85 | |
| d2h1ia1 | 202 | Carboxylesterase {Bacillus cereus [TaxId: 1396]} | 96.84 | |
| d1uwca_ | 261 | Feruloyl esterase A {Aspergillus niger [TaxId: 506 | 96.82 | |
| d1sfra_ | 288 | Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 | 96.77 | |
| d3tgla_ | 265 | Triacylglycerol lipase {Rhizomucor miehei [TaxId: | 96.76 | |
| d1l7aa_ | 318 | Cephalosporin C deacetylase {Bacillus subtilis [Ta | 96.67 | |
| d1mpxa2 | 381 | Alpha-amino acid ester hydrolase {Xanthomonas citr | 96.53 | |
| d1r88a_ | 267 | Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta | 96.5 | |
| d1dqza_ | 280 | Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 | 96.44 | |
| d1vlqa_ | 322 | Acetyl xylan esterase TM0077 {Thermotoga maritima | 96.19 | |
| d1bu8a2 | 338 | Pancreatic lipase, N-terminal domain {Rat (Rattus | 96.18 | |
| d1xfda2 | 258 | Dipeptidyl aminopeptidase-like protein 6, DPP6, C- | 96.16 | |
| d1rp1a2 | 337 | Pancreatic lipase, N-terminal domain {Dog (Canis f | 96.13 | |
| d1ju3a2 | 347 | Bacterial cocaine esterase N-terminal domain {Rhod | 96.1 | |
| d1lnsa3 | 405 | X-Prolyl dipeptidyl aminopeptidase PepX, middle do | 95.88 | |
| d1cexa_ | 197 | Cutinase {Fungus (Fusarium solani), subsp. pisi [T | 95.82 | |
| d1dina_ | 233 | Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI | 95.78 | |
| d3c8da2 | 246 | Enterochelin esterase, catalytic domain {Shigella | 95.6 | |
| d2b9va2 | 385 | Alpha-amino acid ester hydrolase {Acetobacter past | 95.48 | |
| d1jjfa_ | 255 | Feruloyl esterase domain of the cellulosomal xylan | 95.38 | |
| d2bgra2 | 258 | Dipeptidyl peptidase IV/CD26, C-terminal domain {P | 95.06 | |
| d1auoa_ | 218 | Carboxylesterase {Pseudomonas fluorescens [TaxId: | 94.86 | |
| d1wb4a1 | 273 | Feruloyl esterase domain of the cellulosomal xylan | 94.59 | |
| d1pv1a_ | 299 | Hypothetical esterase YJL068C {Baker's yeast (Sacc | 93.58 | |
| d1jkma_ | 358 | Carboxylesterase {Bacillus subtilis, brefeldin A e | 93.56 | |
| d1qoza_ | 207 | Acetylxylan esterase {Trichoderma reesei [TaxId: 5 | 93.17 | |
| d1jjia_ | 311 | Carboxylesterase {Archaeon Archaeoglobus fulgidus | 92.85 | |
| d1lzla_ | 317 | Heroin esterase {Rhodococcus sp. [TaxId: 1831]} | 92.53 | |
| d1g66a_ | 207 | Acetylxylan esterase {Penicillium purpurogenum [Ta | 92.32 | |
| d1qlwa_ | 318 | A novel bacterial esterase {Alcaligenes sp. [TaxId | 89.08 | |
| d2gzsa1 | 265 | Enterobactin and salmochelin hydrolase IroE {Esche | 87.65 | |
| d2d81a1 | 318 | Polyhydroxybutyrate depolymerase {Penicillium funi | 85.94 | |
| d1u4na_ | 308 | Carboxylesterase {Alicyclobacillus acidocaldarius | 85.02 | |
| d1ispa_ | 179 | Lipase A {Bacillus subtilis [TaxId: 1423]} | 81.39 |
| >d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: alpha/beta-Hydrolases superfamily: alpha/beta-Hydrolases family: Bacterial lipase domain: Lipase species: Pseudomonas aeruginosa [TaxId: 287]
Probab=99.37 E-value=7.5e-13 Score=126.54 Aligned_cols=89 Identities=21% Similarity=0.253 Sum_probs=77.1
Q ss_pred hHHHHHHHHHHCCCee-ecCcccCCCCCCCCchHHHHHHHHHHHHHHHHHHhCCCcEEEEEeChhHHHHHHHHHhcCccc
Q 013182 113 HFHDMIEMLVKCGYKK-GTTLFGYGYDFRQSNRIDKLMEGLKVKLETAYKASGNRKVTLITHSMGGLLVMCFMSLHKDVF 191 (448)
Q Consensus 113 ~~~~l~~~L~~~Gy~v-~~dl~g~~yd~r~~~~~~~~~~~L~~~Ie~~~~~~~~~kv~LVGHSMGGlva~~~l~~~~~~~ 191 (448)
||+.+.+.|++.||+| ..|+++++- ....+++|.+.|+++.+..+.+||+||||||||+++++++..+|+
T Consensus 27 yw~~i~~~L~~~G~~v~~~~~~~~~~-------~~~~a~~l~~~i~~~~~~~g~~~v~ligHS~GG~~~r~~~~~~p~-- 97 (285)
T d1ex9a_ 27 YWFGIPSALRRDGAQVYVTEVSQLDT-------SEVRGEQLLQQVEEIVALSGQPKVNLIGHSHGGPTIRYVAAVRPD-- 97 (285)
T ss_dssp SSTTHHHHHHHTTCCEEEECCCSSSC-------HHHHHHHHHHHHHHHHHHHCCSCEEEEEETTHHHHHHHHHHHCGG--
T ss_pred hHHHHHHHHHhCCCEEEEeCCCCCCC-------cHHHHHHHHHHHHHHHHHcCCCeEEEEEECccHHHHHHHHHHCCc--
Confidence 5788999999999999 778877652 234567888888888888888899999999999999999999998
Q ss_pred cccccEEEEEcCCCCCChHHH
Q 013182 192 SKFVNKWITIASPFQGAPGCI 212 (448)
Q Consensus 192 ~~~V~~~I~i~~P~~Gs~~a~ 212 (448)
+|+++|+|++|+.|++.|-
T Consensus 98 --~v~~lv~i~tPh~Gs~~ad 116 (285)
T d1ex9a_ 98 --LIASATSVGAPHKGSDTAD 116 (285)
T ss_dssp --GEEEEEEESCCTTCCHHHH
T ss_pred --cceeEEEECCCCCCCHHHH
Confidence 8999999999999998763
|
| >d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} | Back information, alignment and structure |
|---|
| >d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} | Back information, alignment and structure |
|---|
| >d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} | Back information, alignment and structure |
|---|
| >d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} | Back information, alignment and structure |
|---|
| >d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} | Back information, alignment and structure |
|---|
| >d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} | Back information, alignment and structure |
|---|
| >d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} | Back information, alignment and structure |
|---|
| >d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} | Back information, alignment and structure |
|---|
| >d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} | Back information, alignment and structure |
|---|
| >d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} | Back information, alignment and structure |
|---|
| >d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} | Back information, alignment and structure |
|---|
| >d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} | Back information, alignment and structure |
|---|
| >d1ku0a_ c.69.1.18 (A:) Lipase L1 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} | Back information, alignment and structure |
|---|
| >d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} | Back information, alignment and structure |
|---|
| >d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} | Back information, alignment and structure |
|---|
| >d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} | Back information, alignment and structure |
|---|
| >d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} | Back information, alignment and structure |
|---|
| >d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} | Back information, alignment and structure |
|---|
| >d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} | Back information, alignment and structure |
|---|
| >d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} | Back information, alignment and structure |
|---|
| >d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]} | Back information, alignment and structure |
|---|
| >d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]} | Back information, alignment and structure |
|---|
| >d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} | Back information, alignment and structure |
|---|
| >d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} | Back information, alignment and structure |
|---|
| >d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]} | Back information, alignment and structure |
|---|
| >d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} | Back information, alignment and structure |
|---|
| >d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} | Back information, alignment and structure |
|---|
| >d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} | Back information, alignment and structure |
|---|
| >d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} | Back information, alignment and structure |
|---|
| >d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} | Back information, alignment and structure |
|---|
| >d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} | Back information, alignment and structure |
|---|
| >d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1cexa_ c.69.1.30 (A:) Cutinase {Fungus (Fusarium solani), subsp. pisi [TaxId: 169388]} | Back information, alignment and structure |
|---|
| >d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} | Back information, alignment and structure |
|---|
| >d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} | Back information, alignment and structure |
|---|
| >d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1qoza_ c.69.1.30 (A:) Acetylxylan esterase {Trichoderma reesei [TaxId: 51453]} | Back information, alignment and structure |
|---|
| >d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1g66a_ c.69.1.30 (A:) Acetylxylan esterase {Penicillium purpurogenum [TaxId: 28575]} | Back information, alignment and structure |
|---|
| >d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} | Back information, alignment and structure |
|---|
| >d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]} | Back information, alignment and structure |
|---|
| >d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} | Back information, alignment and structure |
|---|
| >d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|