Citrus Sinensis ID: 013206


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------
MASTEPWLMENGSVKVLSKEIRHGRTAHNMSSSSLRKKSDLTLVSKIRFPCLRRCLANIQEVILGTKLSVLFPAIPLAIIGQCFGFAEPWVFALSLLGLTPLAERVSFLTEQIAFYTGPTVGGLLNATCGNATELIIAIFALYGRKIDVVKYSLLGSILSNLLLVLGTSLFCGGIANLRKEQKYDRKQADVNSLLLLLALLCHMLPLLFKYAAASSDITAKATLQLSRASSIVMLIGYFAYLVFQLWTHREFFEAQEDSEDDDDVTEETPVIGFWSGFAWLVGMTAIIALLSEFVVGTIEDASNSWGISVSFISIILLPIVGNAAEHAGAIIFAFKNKLDISLGVALGSATQIAVFVVPLCVIISWIMGITMDLNFNLLETGSLALAIIATAFTLQDGTSHYMKGFVLLLCYFVIGACFFVSNRPLDSDPNGVKMGLQSSTGTVFRA
cccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHcccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHEEEEccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEcccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccc
*****************************************TLVSKIRFPCLRRCLANIQEVILGTKLSVLFPAIPLAIIGQCFGFAEPWVFALSLLGLTPLAERVSFLTEQIAFYTGPTVGGLLNATCGNATELIIAIFALYGRKIDVVKYSLLGSILSNLLLVLGTSLFCGGIANLRKEQKYDRKQADVNSLLLLLALLCHMLPLLFKYAAASSDITAKATLQLSRASSIVMLIGYFAYLVFQLWTHREFFEA************ETPVIGFWSGFAWLVGMTAIIALLSEFVVGTIEDASNSWGISVSFISIILLPIVGNAAEHAGAIIFAFKNKLDISLGVALGSATQIAVFVVPLCVIISWIMGITMDLNFNLLETGSLALAIIATAFTLQDGTSHYMKGFVLLLCYFVIGACFFVSNRP**********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASTEPWLMENGSVKVLSKEIRHGRTAHNMSSSSLRKKSDLTLVSKIRFPCLRRCLANIQEVILGTKLSVLFPAIPLAIIGQCFGFAEPWVFALSLLGLTPLAERVSFLTEQIAFYTGPTVGGLLNATCGNATELIIAIFALYGRKIDVVKYSLLGSILSNLLLVLGTSLFCGGIANLRKEQKYDRKQADVNSLLLLLALLCHMLPLLFKYAAASSDITAKATLQLSRASSIVMLIGYFAYLVFQLWTHREFFEAQEDSEDDDDVTEETPVIGFWSGFAWLVGMTAIIALLSEFVVGTIEDASNSWGISVSFISIILLPIVGNAAEHAGAIIFAFKNKLDISLGVALGSATQIAVFVVPLCVIISWIMGITMDLNFNLLETGSLALAIIATAFTLQDGTSHYMKGFVLLLCYFVIGACFFVSNRPLDSDPNGVKMGLQSSTGTVFRA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Vacuolar cation/proton exchanger 3 Vacuolar cation/proton exchanger (CAX). Translocates Ca(2+) and other metal ions into vacuoles using the proton gradient formed by H(+)-ATPase and H(+)-pyrophosphatase (By similarity). Involved in ion homeostasis in association with CAX1.confidentQ93Z81
Vacuolar cation/proton exchanger 1a Vacuolar cation/proton exchanger (CAX). Translocates Ca(2+) and other metal ions into vacuoles using the proton gradient formed by H(+)-ATPase and H(+)-pyrophosphatase.probableQ769E5
Vacuolar calcium ion transporter Has a role in promoting intracellular calcium ion sequestration via the exchange of calcium ions for hydrogen ions across the vacuolar membrane. Involved also in manganese ion homeostasis via its uptake into the vacuole.probableQ99385

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3V5U, chain A
Confidence level:very confident
Coverage over the Query: 103-207,219-251,269-421
View the alignment between query and template
View the model in PyMOL