BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 013213
         (447 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2RJQ|A Chain A, Crystal Structure Of Adamts5 With Inhibitor Bound
          Length = 378

 Score = 29.6 bits (65), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 13/62 (20%)

Query: 222 YDDETRSEQAAVSIHSRRLSASIDTTIDESPKIVEVDTGSNRPKSRSRRTNTSVSDFSDD 281
           +DD    E+   S   +RL +SI T+ID S             K  S+ T+ ++++F DD
Sbjct: 159 HDDSKFCEETFGSTEDKRLMSSILTSIDAS-------------KPWSKCTSATITEFLDD 205

Query: 282 PH 283
            H
Sbjct: 206 GH 207


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.315    0.127    0.374 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,479,305
Number of Sequences: 62578
Number of extensions: 342482
Number of successful extensions: 717
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 717
Number of HSP's gapped (non-prelim): 5
length of query: 447
length of database: 14,973,337
effective HSP length: 102
effective length of query: 345
effective length of database: 8,590,381
effective search space: 2963681445
effective search space used: 2963681445
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 53 (25.0 bits)