Citrus Sinensis ID: 013289


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440------
MGFDDTNECPQLCKLAYEYLKKSKGCEDNIYEYFSKEAEPESLYVKLVEEFDRCILSYFTFHWSHASLMISQVLSVESEKKTKLKDFIMAATRKQRFEKVTKDLKMKRVFSTLVEEMKAIRREGESHCTDVMVPAALSERSPVLLLMGGGMGAGKSTVLKDIMKESFWSGAATNAVVVEADAFKETDVIYRALSSKGHHDDMLQTAELVHQSSTDAASSLLVTALNEGRDVIMDGTLSWVPFVEQTIAMARNVHKSRYRMGVGYKVNEDGTVIENYWEQVKEGEEDYQQKENRQVFSRKPYRIELVGVVCDAYLAVVRGIRRAIMMKRAVRVNSQLKSHKRFANAFRNYCELVDNARLYCTNAVGGPPRLIAWKDGDSNLLVDSDEIKCLTRVGSLNADADSVYELHSEPNPIFEPGSVWNDIVLCPSRAGLQLELRTSIKKIENY
cccccccccHHHHHHHHHHHHcccccHHHHHHHHHcccccHHHHHHHHHHHHHHHccccEEEccccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccccccccccccccccEEEEEcccccccHHHHHHHHHHHcccccccccEEEEcccccccccHHHHHHHcccccccHHHHHHHHcccHHHHHHHHHHHHHHccccEEECcccccHHHHHHHHHHHHHHHHHcccccccEEEccccccHHHHHHHHHHcHHHHHHHcccccccccccEEEEEEEEEcHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccEEEECcccccccccEEEEEcccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcc
*G****NECPQLCKLAYEYLKKSKGCEDNIYEYFSKEAEPESLYVKLVEEFDRCILSYFTFHWSHASLMISQVLSVESEKKTKLKDFIMAATRKQRFEKVTKDLKMKRVFSTLVEEMKAIRREGESHCTDVMVPAALSERSPVLLLMGGGMGAGKSTVLKDIMKESFWSGAATNAVVVEADAFKETDVIYRALSSK***DDMLQTAELVHQSSTDAASSLLVTALNEGRDVIMDGTLSWVPFVEQTIAMARNVHKSRYRMGVGYKVNEDGTVIENYWEQVK************QVFSRKPYRIELVGVVCDAYLAVVRGIRRAIMMKRAVRVNSQLKSHKRFANAFRNYCELVDNARLYCTNAVGGPPRLIAWKDGDSNLLVDSDEIKCLTRVGSLNADADSVYELHSEPNP*FEPGSVWNDIVLCPSRAGLQLELRTSIKKI***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGFDDTNECPQLCKLAYEYLKKSKGCEDNIYEYFSKEAEPESLYVKLVEEFDRCILSYFTFHWSHASLMISQVLSVESEKKTKLKDFIMAATRKQRFEKVTKDLKMKRVFSTLVEEMKAIRREGESHCTDVMVPAALSERSPVLLLMGGGMGAGKSTVLKDIMKESFWSGAATNAVVVEADAFKETDVIYRALSSKGHHDDMLQTAELVHQSSTDAASSLLVTALNEGRDVIMDGTLSWVPFVEQTIAMARNVHKSRYRMGVGYKVNEDGTVIENYWEQVKEGEEDYQQKENRQVFSRKPYRIELVGVVCDAYLAVVRGIRRAIMMKRAVRVNSQLKSHKRFANAFRNYCELVDNARLYCTNAVGGPPRLIAWKDGDSNLLVDSDEIKCLTRVGSLNADADSVYELHSEPNPIFEPGSVWNDIVLCPSRAGLQLELRTSIKKIENY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfer were detected in SWISS-PROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2P5T, chain B
Confidence level:very confident
Coverage over the Query: 139-249,296-360
View the alignment between query and template
View the model in PyMOL
Template: 1LTQ, chain A
Confidence level:confident
Coverage over the Query: 142-250,297-405
View the alignment between query and template
View the model in PyMOL
Template: 3CZP, chain A
Confidence level:probable
Coverage over the Query: 140-247,263-349
View the alignment between query and template
View the model in PyMOL
Template: 1KO7, chain A
Confidence level:probable
Coverage over the Query: 85-183
View the alignment between query and template
View the model in PyMOL