Citrus Sinensis ID: 013301

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440------
MPAGVLTKLNPTVCSGFNRVCNPKSSVLRRGKVLFANSGSSEFLPYPIRLLSETMDFSLSSSCKRSSIPSSGTKAVGGDVLIDDLVSNCGNGLEFAKSSGVYFNDRSQSRCHKARMSSRKRESPSGGLVSGYFIFDSVGRSSKSNVLGGGLCLKNIHTSSSMCFSAGSAHDLSFDGGSRNELIGSVASEQTILGERALKLLSGSCYLPHPAKEETGGEDAHFICGDEQVIGVADGVGGWADVGVDAGEFARELMSHSFRAVQEESTHAIDPARVLEKAHSSTKAKGSSTACIIALTSKAIHAVNLGDSGFMVVRDGCTIFQSPVQQHGFNFTYQLESGNTGDLPSSGQVFTIPAAPGDVIVAGTDGLFDNLYNNEVTAVVVHALRAGLGPQVTAQKIAALARQRAQDRNRQTPFSTAAQDAGFRYYGGKLDDITVIVSYISGHASV
ccccccccccccccccccEEEcccccEECccccEECccccccccccccccccccccccccccccccccccccccCCccccccccHHccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEECccccccccccccccEEEEccccEEEEEEccCCcccccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHccccccEEEEEEEccEEEEEEEccccEEEEEccEEEEEcccCECcccccccccccccccccccccEEEEEcccccEEEEEcccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHccccccccccccEEEEEEEEcccccc
****VLTKLNPTVCSGFNRVCNPKSSVLRRGKVLFANSGSSEFLPYPIRLLSETM*******************AVGGDVLIDDLVSNCGNGLEFAKSSGVYF************************LVSGYFIFDSVGRSSKSNVLGGGLCLKNIHTSSSMCFSA**AHD**F********************ERALKLLSGSCYLPHPAKEETGGEDAHFICGDEQVIGVADGVGGWADVGVDAGEFARELMSHSFRAVQEESTHAIDPARVLEKAHSSTKAKGSSTACIIALTSKAIHAVNLGDSGFMVVRDGCTIFQSPVQQHGFNFTYQLESGNTGDLPSSGQVFTIPAAPGDVIVAGTDGLFDNLYNNEVTAVVVHALRAGLGPQVTAQKIAALARQRAQDRNRQTPFSTAAQDAGFRYYGGKLDDITVIVSYISGH***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPAGVLTKLNPTVCSGFNRVCNPKSSVLRRGKVLFANSGSSEFLPYPIRLLSETMDFSLSSSCKRSSIPSSGTKAVGGDVLIDDLVSNCGNGLEFAKSSGVYFNDRSQSRCHKARMSSRKRESPSGGLVSGYFIFDSVGRSSKSNVLGGGLCLKNIHTSSSMCFSAGSAHDLSFDGGSRNELIGSVASEQTILGERALKLLSGSCYLPHPAKEETGGEDAHFICGDEQVIGVADGVGGWADVGVDAGEFARELMSHSFRAVQEESTHAIDPARVLEKAHSSTKAKGSSTACIIALTSKAIHAVNLGDSGFMVVRDGCTIFQSPVQQHGFNFTYQLESGNTGDLPSSGQVFTIPAAPGDVIVAGTDGLFDNLYNNEVTAVVVHALRAGLGPQVTAQKIAALARQRAQDRNRQTPFSTAAQDAGFRYYGGKLDDITVIVSYISGHASV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable protein phosphatase 2C 80 probableQ9LVQ8

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2JFR, chain A
Confidence level:very confident
Coverage over the Query: 199-404,428-440
View the alignment between query and template
View the model in PyMOL
Template: 2PNQ, chain A
Confidence level:confident
Coverage over the Query: 208-403,429-442
View the alignment between query and template
View the model in PyMOL