Citrus Sinensis ID: 013352

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440----

MDEEYDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESSSLNLIQLWKRFRGNEQPPAHLGSSRDYNVDMIPKFIIANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDMEALKSPLMGIFEKRRARKFFIYVQDYDENDPKTHEGMDLTRVTTRELIAKYGLDDNTIDFIGHALALHRDDRYLNEPALDTVKRMKLYAESIARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEEGKVVGVTSEGETAKCKKVVCDPSYLPNKVRKVGRVARAIAIMSHPIPNTNDSHSVQVILPQKQLGRRSDMYLFCCSYSHNVAPKGKFIAFVSTEAETDHPQTELKPGIDLLGPVDEIFYDIYDRYEPVNEPSLDNCFISTSYDATTHFESTVTDVLNMYTMITGKVLDLSVDLSAASAAEE

ccccccEEEEccccHHHHHHHHHHHcccCEcccccccccccccccccHHHHHHHcccccccccccccccccCEcccccEEEccccHHHHEEEcccEEEEEEEECccEEEEEccEEEcccccHHHHHccccccHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHccccHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHcccccccEEEEcccccHHHHHHHHHHHHcccCEECcccccEEEEcccccEEEEEEcccEEEEEEEEEccccccccccEEcEEEEEEEEcccccccccccccEEEEcccccccccccEEEEEEccccCCcccccEEEEEEEEccccccccccHHHHHcccccccEEEEEEcccccccccccccEEEccccccccccHHHHHHHHHHHHHHccccccccccccccccccc

MDEEYDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESSSLNLIQLWKRFRGNEQPPAHLGSSRDYNVDMIPKFIIANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDMEALKSPLMGIFEKRRARKFFIYVQDYDENDPKTHEGMDLTRVTTRELIAKYGLDDNTIDFIGHALALHRDDRYLNEPALDTVKRMKLYAESIARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEEGKVVGVTSEGETAKCKKVVCDPSYLPNKVRKVGRVARAIAIMSHPIPNTNDSHSVQVILPQKQLGRRSDMYLFCCSYSHNVAPKGKFIAFVSTEA*******ELKPGIDLLGPVDEIFYDIYDRYEPVNEPSLDNCFISTSYDATTHFESTVTDVLNMYTMITGKVLDLSVD*********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Rab GDP dissociation inhibitor alpha	Regulates the GDP/GTP exchange reaction of most Rab proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them.	probable	P50398
Rab GDP dissociation inhibitor alpha	Regulates the GDP/GTP exchange reaction of most Rab proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them.	probable	O97555
Rab GDP dissociation inhibitor alpha	Regulates the GDP/GTP exchange reaction of most Rab proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them.	probable	P50396

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3P1W, chain A
Confidence level:very confident
Coverage over the Query: 1-432
View the alignment between query and template
View the model in PyMOL