Citrus Sinensis ID: 013360
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 444 | ||||||
| 225429824 | 449 | PREDICTED: uncharacterized protein LOC10 | 1.0 | 0.988 | 0.674 | 1e-171 | |
| 255574131 | 440 | conserved hypothetical protein [Ricinus | 0.979 | 0.988 | 0.700 | 1e-171 | |
| 224121216 | 446 | predicted protein [Populus trichocarpa] | 1.0 | 0.995 | 0.692 | 1e-170 | |
| 224115694 | 447 | predicted protein [Populus trichocarpa] | 1.0 | 0.993 | 0.686 | 1e-168 | |
| 363806748 | 446 | uncharacterized protein LOC100781922 pre | 0.984 | 0.979 | 0.644 | 1e-162 | |
| 357466595 | 439 | hypothetical protein MTR_3g109330 [Medic | 0.975 | 0.986 | 0.646 | 1e-161 | |
| 449509133 | 448 | PREDICTED: LOW QUALITY PROTEIN: uncharac | 1.0 | 0.991 | 0.602 | 1e-149 | |
| 449437044 | 448 | PREDICTED: uncharacterized protein LOC10 | 1.0 | 0.991 | 0.600 | 1e-149 | |
| 388521969 | 435 | unknown [Lotus japonicus] | 0.970 | 0.990 | 0.625 | 1e-147 | |
| 217074086 | 404 | unknown [Medicago truncatula] | 0.896 | 0.985 | 0.634 | 1e-143 |
| >gi|225429824|ref|XP_002280828.1| PREDICTED: uncharacterized protein LOC100254151 [Vitis vinifera] gi|296081785|emb|CBI20790.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 608 bits (1569), Expect = e-171, Method: Compositional matrix adjust.
Identities = 303/449 (67%), Positives = 359/449 (79%), Gaps = 5/449 (1%)
Query: 1 MAASKLVIFSLFFALILTA--ADVSIQGEDVP-PLTASDAVDSSPLKIELDQLKSKIRSL 57
M ASKL +FFALI AD SI D P + S++ +S LKIEL L+ KI++L
Sbjct: 1 MGASKLATLFIFFALIFCKIRADASIDEVDQPQGVVLSESSESEALKIELALLQEKIQTL 60
Query: 58 ESHIDEKTQELKGKDEVVAQKEKAIQDKSERIVSLQKELSSLQKKETLNAAEQVDKAHAR 117
E+HIDE+++ELK KDE++AQKEK +Q+KS I LQ E+ SLQKK T +A EQ+ KA+AR
Sbjct: 61 ETHIDERSKELKSKDEIIAQKEKIVQEKSNSITQLQNEIVSLQKKGTSDAEEQLGKAYAR 120
Query: 118 ADELEKQIDNLKKESEKQQKEKEALEARAIEAEKKISDLSAKLEKLQKINDEQKSKIRKT 177
A ELEKQ+D LKKE E QQKEK ALE+RA EAE+K +L++K+E L+KI DEQK++IRKT
Sbjct: 121 ASELEKQVDKLKKEIETQQKEKAALESRANEAERKTRELNSKVESLKKITDEQKTRIRKT 180
Query: 178 ERALKVAEEEMMRAKFEATSRSKELTEVHSAWLPPWLAVHLLQCQSLIETHWNAHGKPAM 237
ERAL+VAEEEMM+AKF+A S++KEL EVH AWLPPW A HL+ CQS +E HWN HGKPA+
Sbjct: 181 ERALQVAEEEMMKAKFDANSKTKELMEVHGAWLPPWFANHLISCQSFMEVHWNKHGKPAL 240
Query: 238 DVAIQKALEKKAQAGKWVQPHVETIKAKWIPAVKEQWVVFTTNVEPHVQTLKTKTIEACE 297
D QKALEKKAQA KW +PHVET K KWIPA+K+QW+ TT +EPHVQ L TKT+EA E
Sbjct: 241 DTLTQKALEKKAQAQKWSEPHVETFKTKWIPAIKDQWLEITTYLEPHVQLLCTKTVEAYE 300
Query: 298 ATKTAVTPHIIRVQEVVDPYFQEAKKFSKPYIDQVATVAKPHVDNVRVALKPYTKKVVRA 357
A+K A+TPH+I+VQE DPYFQ AKK SKPYIDQVA V KPHVDNV+VALKPYTKKVVR
Sbjct: 301 ASKNAITPHVIKVQEFGDPYFQVAKKVSKPYIDQVAAVTKPHVDNVKVALKPYTKKVVRG 360
Query: 358 YGKFLKSATTYHHQVQASVQEMLKKHELTSPLATKELEWFAASALLVLPVIILFRIGSAI 417
YGKFLKSATTYH +VQ +VQE LK HELT PLATKEL WFAASALL LP+I LFRI SAI
Sbjct: 361 YGKFLKSATTYHQKVQDTVQEKLKNHELTKPLATKELVWFAASALLALPIIFLFRICSAI 420
Query: 418 FCKKARKPVR--HSHHHSRRKAKRGHPDK 444
FCKKA+KP+R H++HH RRK KRGHPDK
Sbjct: 421 FCKKAKKPIRNGHTNHHPRRKPKRGHPDK 449
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255574131|ref|XP_002527981.1| conserved hypothetical protein [Ricinus communis] gi|223532607|gb|EEF34393.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224121216|ref|XP_002330772.1| predicted protein [Populus trichocarpa] gi|118485922|gb|ABK94806.1| unknown [Populus trichocarpa] gi|222872574|gb|EEF09705.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224115694|ref|XP_002332119.1| predicted protein [Populus trichocarpa] gi|118488228|gb|ABK95933.1| unknown [Populus trichocarpa] gi|222874939|gb|EEF12070.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|363806748|ref|NP_001242275.1| uncharacterized protein LOC100781922 precursor [Glycine max] gi|255642485|gb|ACU21506.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357466595|ref|XP_003603582.1| hypothetical protein MTR_3g109330 [Medicago truncatula] gi|355492630|gb|AES73833.1| hypothetical protein MTR_3g109330 [Medicago truncatula] gi|388509130|gb|AFK42631.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|449509133|ref|XP_004163503.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101229984 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449437044|ref|XP_004136302.1| PREDICTED: uncharacterized protein LOC101216465 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|388521969|gb|AFK49046.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|217074086|gb|ACJ85403.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 444 | ||||||
| TAIR|locus:2128166 | 437 | AT4G31340 "AT4G31340" [Arabido | 0.932 | 0.947 | 0.555 | 2.8e-121 | |
| TAIR|locus:2061067 | 440 | AT2G24420 [Arabidopsis thalian | 0.927 | 0.936 | 0.535 | 1.6e-116 | |
| TAIR|locus:2126470 | 388 | AT4G30090 "AT4G30090" [Arabido | 0.585 | 0.670 | 0.333 | 1.6e-38 | |
| UNIPROTKB|F1PCW0 | 2240 | GOLGA4 "Uncharacterized protei | 0.702 | 0.139 | 0.225 | 1.3e-08 | |
| SGD|S000002764 | 944 | SPC110 "Inner plaque spindle p | 0.373 | 0.175 | 0.248 | 6.8e-06 | |
| UNIPROTKB|H0Y6I0 | 2099 | GOLGA4 "Golgin subfamily A mem | 0.695 | 0.147 | 0.214 | 1e-05 | |
| UNIPROTKB|Q13439 | 2230 | GOLGA4 "Golgin subfamily A mem | 0.695 | 0.138 | 0.214 | 1.1e-05 | |
| TAIR|locus:2099114 | 318 | PMD1 "peroxisomal and mitochon | 0.468 | 0.654 | 0.235 | 2e-05 | |
| DICTYBASE|DDB_G0286985 | 1024 | zipA "zipper-like domain-conta | 0.416 | 0.180 | 0.228 | 2.7e-05 | |
| WB|WBGene00002978 | 284 | lev-11 [Caenorhabditis elegans | 0.387 | 0.605 | 0.186 | 3.4e-05 |
| TAIR|locus:2128166 AT4G31340 "AT4G31340" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1193 (425.0 bits), Expect = 2.8e-121, P = 2.8e-121
Identities = 234/421 (55%), Positives = 306/421 (72%)
Query: 1 MAASKLVIFSLFFALILTAADVSIQGEDVPPLTASDAVDSSPLKIELDQLKSKIRSLESH 60
MAA+KLV L AL+ T + + D P ++ + D S KI LDQL +KIR+LES
Sbjct: 1 MAAAKLVAL-LLLALLFTTSVFA--DADEPEVSEAAGSDGSS-KIHLDQLNAKIRALESQ 56
Query: 61 IDEKTQELKGKDEVVAQKEKAIQDKSERIVSLQKELSSLQKKETLNAAEQVDKAHARADE 120
IDEKT+E++GKDEVVA+KEK ++++ ++I SLQ E+SSLQKK + ++A+Q+ KA ARADE
Sbjct: 57 IDEKTREVQGKDEVVAEKEKLLKEREDKIASLQTEVSSLQKKGSSDSAKQLGKAQARADE 116
Query: 121 LEKQIDNXXXXXXXXXXXXXXXXXRAIEAEKKISDLSAKLEKLQKINDEQKSKIRKTERA 180
LEKQ++ R EAEKK+ +L++ L+KLQK N+EQK+KI K ERA
Sbjct: 117 LEKQVEVLKNFLEQKNKEKDSTEARTNEAEKKLRELNSSLDKLQKTNEEQKNKIGKLERA 176
Query: 181 LKVAEEEMMRAKFEATSRSKELTEVHSAWLPPWLAVHLLQCQSLIETHWNAHGKPAMDVA 240
+K+AEEEM+R K EAT+++KEL E H +WLPPWLAVH + Q+ ETHW AHGKPA++
Sbjct: 177 IKIAEEEMLRTKLEATTKAKELLEAHGSWLPPWLAVHWFKFQTYTETHWEAHGKPAVETV 236
Query: 241 IQKALEKKAQAGKWVQPHVETIKAKWIPAVKEQWVVFTTNVEPHVQTLKTKTIEACEATK 300
I K E KAQA KW +PHVE +K K+IPA+KE T +VEPH +TL K EA ++K
Sbjct: 237 ILKVTEAKAQAEKWAEPHVENVKTKYIPAIKE---TVTIHVEPHFRTLSIKAKEAYHSSK 293
Query: 301 TAVTPHIIRVQEVVDPYFQEAKKFSKPYIDQVATVAKPHVDNVRVALKPYTKKVVRAYGK 360
+AV+PHI+ VQE VDPY+QEAKKFSKPY+DQVAT KPHVD ++VA+KPYT KV+ Y +
Sbjct: 294 SAVSPHIVTVQEFVDPYYQEAKKFSKPYVDQVATTTKPHVDKMKVAMKPYTTKVIIVYTE 353
Query: 361 FLKSATTYHHQVQASVQEMLKKHELTSPLATKELEWFAASALLVLPVIILFRIGSAIFCK 420
FL+SATTYH+QVQA V+ LK HELT P AT E WFAASALLV P+ + +R+ S++FC
Sbjct: 354 FLESATTYHNQVQAHVERKLKSHELTEPFATNEFVWFAASALLVFPIFVAYRVLSSLFCT 413
Query: 421 K 421
K
Sbjct: 414 K 414
|
|
| TAIR|locus:2061067 AT2G24420 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2126470 AT4G30090 "AT4G30090" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PCW0 GOLGA4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| SGD|S000002764 SPC110 "Inner plaque spindle pole body (SPB) component" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H0Y6I0 GOLGA4 "Golgin subfamily A member 4" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q13439 GOLGA4 "Golgin subfamily A member 4" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2099114 PMD1 "peroxisomal and mitochondrial division factor 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0286985 zipA "zipper-like domain-containing protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00002978 lev-11 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 444 | |||
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 5e-14 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 4e-12 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-11 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-10 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 3e-10 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 9e-10 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 9e-10 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 1e-09 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-09 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 3e-09 | |
| COG1579 | 239 | COG1579, COG1579, Zn-ribbon protein, possibly nucl | 5e-09 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 6e-09 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 6e-09 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 1e-08 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 2e-08 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 3e-08 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 6e-08 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-07 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 1e-07 | |
| TIGR03319 | 514 | TIGR03319, RNase_Y, ribonuclease Y | 1e-07 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-07 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-07 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 2e-07 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 6e-07 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 6e-07 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 7e-07 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 8e-07 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 8e-07 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 8e-07 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-06 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 1e-06 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-06 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-06 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 2e-06 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 3e-06 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 4e-06 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 4e-06 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 6e-06 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 6e-06 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 7e-06 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-05 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 1e-05 | |
| COG1579 | 239 | COG1579, COG1579, Zn-ribbon protein, possibly nucl | 1e-05 | |
| PRK00106 | 535 | PRK00106, PRK00106, hypothetical protein; Provisio | 1e-05 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-05 | |
| pfam05262 | 489 | pfam05262, Borrelia_P83, Borrelia P83/100 protein | 2e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 3e-05 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 4e-05 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 4e-05 | |
| TIGR04211 | 198 | TIGR04211, SH3_and_anchor, SH3 domain protein | 4e-05 | |
| pfam12329 | 74 | pfam12329, TMF_DNA_bd, TATA element modulatory fac | 4e-05 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 5e-05 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 7e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 8e-05 | |
| TIGR04211 | 198 | TIGR04211, SH3_and_anchor, SH3 domain protein | 8e-05 | |
| TIGR03319 | 514 | TIGR03319, RNase_Y, ribonuclease Y | 9e-05 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 9e-05 | |
| PRK09039 | 343 | PRK09039, PRK09039, hypothetical protein; Validate | 9e-05 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 1e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 1e-04 | |
| TIGR04211 | 198 | TIGR04211, SH3_and_anchor, SH3 domain protein | 1e-04 | |
| PRK00409 | 782 | PRK00409, PRK00409, recombination and DNA strand e | 1e-04 | |
| COG5185 | 622 | COG5185, HEC1, Protein involved in chromosome segr | 1e-04 | |
| PRK11637 | 428 | PRK11637, PRK11637, AmiB activator; Provisional | 1e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 2e-04 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 2e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 2e-04 | |
| pfam13166 | 713 | pfam13166, AAA_13, AAA domain | 2e-04 | |
| pfam08614 | 194 | pfam08614, ATG16, Autophagy protein 16 (ATG16) | 2e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 4e-04 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 4e-04 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 4e-04 | |
| PRK10636 | 638 | PRK10636, PRK10636, putative ABC transporter ATP-b | 4e-04 | |
| COG2433 | 652 | COG2433, COG2433, Uncharacterized conserved protei | 4e-04 | |
| TIGR04211 | 198 | TIGR04211, SH3_and_anchor, SH3 domain protein | 5e-04 | |
| COG4372 | 499 | COG4372, COG4372, Uncharacterized protein conserve | 6e-04 | |
| PRK00409 | 782 | PRK00409, PRK00409, recombination and DNA strand e | 7e-04 | |
| pfam03962 | 188 | pfam03962, Mnd1, Mnd1 family | 7e-04 | |
| COG3096 | 1480 | COG3096, MukB, Uncharacterized protein involved in | 9e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.001 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 0.001 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.001 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.001 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.001 | |
| TIGR04211 | 198 | TIGR04211, SH3_and_anchor, SH3 domain protein | 0.001 | |
| pfam08317 | 321 | pfam08317, Spc7, Spc7 kinetochore protein | 0.001 | |
| PRK11281 | 1113 | PRK11281, PRK11281, hypothetical protein; Provisio | 0.001 | |
| COG1283 | 533 | COG1283, NptA, Na+/phosphate symporter [Inorganic | 0.001 | |
| TIGR01554 | 384 | TIGR01554, major_cap_HK97, phage major capsid prot | 0.001 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 0.002 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.002 | |
| pfam04156 | 186 | pfam04156, IncA, IncA protein | 0.002 | |
| pfam01576 | 859 | pfam01576, Myosin_tail_1, Myosin tail | 0.002 | |
| smart00787 | 312 | smart00787, Spc7, Spc7 kinetochore protein | 0.002 | |
| COG1322 | 448 | COG1322, COG1322, Predicted nuclease of restrictio | 0.002 | |
| PRK11448 | 1123 | PRK11448, hsdR, type I restriction enzyme EcoKI su | 0.002 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 0.002 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.003 | |
| pfam08317 | 321 | pfam08317, Spc7, Spc7 kinetochore protein | 0.003 | |
| pfam05667 | 536 | pfam05667, DUF812, Protein of unknown function (DU | 0.003 | |
| pfam00261 | 237 | pfam00261, Tropomyosin, Tropomyosin | 0.003 | |
| PRK05771 | 646 | PRK05771, PRK05771, V-type ATP synthase subunit I; | 0.003 | |
| TIGR04320 | 356 | TIGR04320, Surf_Exclu_PgrA, SEC10/PgrA surface exc | 0.003 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 0.004 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.004 | |
| PRK11281 | 1113 | PRK11281, PRK11281, hypothetical protein; Provisio | 0.004 | |
| pfam14235 | 158 | pfam14235, DUF4337, Domain of unknown function (DU | 0.004 | |
| pfam12072 | 201 | pfam12072, DUF3552, Domain of unknown function (DU | 0.004 | |
| PRK04863 | 1486 | PRK04863, mukB, cell division protein MukB; Provis | 0.004 | |
| TIGR02680 | 1353 | TIGR02680, TIGR02680, TIGR02680 family protein | 0.004 | |
| pfam00012 | 598 | pfam00012, HSP70, Hsp70 protein | 0.004 |
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
Score = 74.0 bits (182), Expect = 5e-14
Identities = 46/166 (27%), Positives = 91/166 (54%), Gaps = 1/166 (0%)
Query: 43 LKIELDQLKSKIRSLESHIDEKTQELKGKDEVVAQKEKAIQDKSERIVSLQKELSSLQKK 102
LK E+++L+ K ++L+ ++E +EL+ + + E+ ++ +R L++E+ L++
Sbjct: 777 LKEEIEELEEKRQALQEELEELEEELEEAERRLDALERELESLEQRRERLEQEIEELEE- 835
Query: 103 ETLNAAEQVDKAHARADELEKQIDNLKKESEKQQKEKEALEARAIEAEKKISDLSAKLEK 162
E E++D+ +ELEK+++ LK+E E+ + EKE LE E E++ +L +L +
Sbjct: 836 EIEELEEKLDELEEELEELEKELEELKEELEELEAEKEELEDELKELEEEKEELEEELRE 895
Query: 163 LQKINDEQKSKIRKTERALKVAEEEMMRAKFEATSRSKELTEVHSA 208
L+ E K +I K L+ E ++ R + E +EL E +
Sbjct: 896 LESELAELKEEIEKLRERLEELEAKLERLEVELPELEEELEEEYED 941
|
Length = 1163 |
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|224495 COG1579, COG1579, Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|224495 COG1579, COG1579, Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|178867 PRK00106, PRK00106, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein | Back alignment and domain information |
|---|
| >gnl|CDD|221533 pfam12329, TMF_DNA_bd, TATA element modulatory factor 1 DNA binding | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein | Back alignment and domain information |
|---|
| >gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181619 PRK09039, PRK09039, hypothetical protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein | Back alignment and domain information |
|---|
| >gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|227512 COG5185, HEC1, Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|236942 PRK11637, PRK11637, AmiB activator; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|221952 pfam13166, AAA_13, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|219934 pfam08614, ATG16, Autophagy protein 16 (ATG16) | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236729 PRK10636, PRK10636, putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225288 COG2433, COG2433, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein | Back alignment and domain information |
|---|
| >gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|202833 pfam03962, Mnd1, Mnd1 family | Back alignment and domain information |
|---|
| >gnl|CDD|225638 COG3096, MukB, Uncharacterized protein involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein | Back alignment and domain information |
|---|
| >gnl|CDD|219791 pfam08317, Spc7, Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >gnl|CDD|236892 PRK11281, PRK11281, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224202 COG1283, NptA, Na+/phosphate symporter [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|233467 TIGR01554, major_cap_HK97, phage major capsid protein, HK97 family | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217933 pfam04156, IncA, IncA protein | Back alignment and domain information |
|---|
| >gnl|CDD|144972 pfam01576, Myosin_tail_1, Myosin tail | Back alignment and domain information |
|---|
| >gnl|CDD|197874 smart00787, Spc7, Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >gnl|CDD|224241 COG1322, COG1322, Predicted nuclease of restriction endonuclease-like fold, RmuC family [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|236912 PRK11448, hsdR, type I restriction enzyme EcoKI subunit R; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219791 pfam08317, Spc7, Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >gnl|CDD|218681 pfam05667, DUF812, Protein of unknown function (DUF812) | Back alignment and domain information |
|---|
| >gnl|CDD|189476 pfam00261, Tropomyosin, Tropomyosin | Back alignment and domain information |
|---|
| >gnl|CDD|235600 PRK05771, PRK05771, V-type ATP synthase subunit I; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|234541 TIGR04320, Surf_Exclu_PgrA, SEC10/PgrA surface exclusion domain | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236892 PRK11281, PRK11281, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222613 pfam14235, DUF4337, Domain of unknown function (DUF4337) | Back alignment and domain information |
|---|
| >gnl|CDD|221408 pfam12072, DUF3552, Domain of unknown function (DUF3552) | Back alignment and domain information |
|---|
| >gnl|CDD|235316 PRK04863, mukB, cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233973 TIGR02680, TIGR02680, TIGR02680 family protein | Back alignment and domain information |
|---|
| >gnl|CDD|215656 pfam00012, HSP70, Hsp70 protein | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 444 | |||
| PRK11637 | 428 | AmiB activator; Provisional | 99.2 | |
| PRK11637 | 428 | AmiB activator; Provisional | 98.84 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 98.75 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 98.51 | |
| PRK09039 | 343 | hypothetical protein; Validated | 98.49 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 98.48 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 98.48 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 98.37 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 98.34 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 98.25 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 98.22 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 98.1 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 98.06 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 98.05 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 98.05 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 98.04 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 98.02 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 97.98 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 97.96 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 97.95 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 97.94 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 97.9 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 97.88 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 97.86 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 97.83 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 97.83 | |
| PRK09039 | 343 | hypothetical protein; Validated | 97.8 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 97.74 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 97.73 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 97.72 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 97.69 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 97.68 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 97.64 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 97.63 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 97.59 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 97.57 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 97.53 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 97.52 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 97.49 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 97.48 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 97.44 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 97.43 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 97.42 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 97.42 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 97.42 | |
| KOG0243 | 1041 | consensus Kinesin-like protein [Cytoskeleton] | 97.4 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 97.39 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 97.38 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 97.36 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 97.33 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 97.32 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 97.27 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 97.27 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 97.27 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 97.24 | |
| PF12795 | 240 | MscS_porin: Mechanosensitive ion channel porin dom | 97.23 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 97.22 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 97.21 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 97.21 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 97.2 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 97.18 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 97.15 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 97.13 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 97.12 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 97.08 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 97.08 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 97.07 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 97.07 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 97.04 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 97.04 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 97.01 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 97.0 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 96.99 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 96.98 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 96.97 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 96.95 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 96.93 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 96.89 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 96.86 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 96.8 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 96.79 | |
| PF12795 | 240 | MscS_porin: Mechanosensitive ion channel porin dom | 96.77 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 96.76 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 96.76 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 96.75 | |
| PRK10929 | 1109 | putative mechanosensitive channel protein; Provisi | 96.74 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 96.73 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 96.71 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 96.7 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 96.69 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 96.67 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 96.67 | |
| KOG1003 | 205 | consensus Actin filament-coating protein tropomyos | 96.65 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 96.63 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 96.61 | |
| PF04012 | 221 | PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T | 96.56 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 96.53 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 96.52 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 96.51 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 96.5 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 96.47 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 96.47 | |
| PF13870 | 177 | DUF4201: Domain of unknown function (DUF4201) | 96.46 | |
| KOG4360 | 596 | consensus Uncharacterized coiled coil protein [Fun | 96.45 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 96.45 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 96.42 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 96.41 | |
| KOG1853 | 333 | consensus LIS1-interacting protein NUDE [Cytoskele | 96.4 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 96.39 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 96.36 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 96.35 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 96.33 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 96.29 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 96.29 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 96.26 | |
| PF09304 | 107 | Cortex-I_coil: Cortexillin I, coiled coil; InterPr | 96.2 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 96.17 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 96.14 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 96.13 | |
| PRK10929 | 1109 | putative mechanosensitive channel protein; Provisi | 96.12 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 96.11 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 96.11 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 96.08 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 96.08 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 96.06 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 96.05 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 96.04 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 96.03 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 96.02 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 96.02 | |
| PF06008 | 264 | Laminin_I: Laminin Domain I; InterPro: IPR009254 L | 95.99 | |
| PF04582 | 326 | Reo_sigmaC: Reovirus sigma C capsid protein; Inter | 95.92 | |
| PF15397 | 258 | DUF4618: Domain of unknown function (DUF4618) | 95.9 | |
| PF13870 | 177 | DUF4201: Domain of unknown function (DUF4201) | 95.86 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 95.85 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 95.81 | |
| KOG4360 | 596 | consensus Uncharacterized coiled coil protein [Fun | 95.8 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 95.8 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 95.79 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 95.79 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 95.76 | |
| PF05384 | 159 | DegS: Sensor protein DegS; InterPro: IPR008595 Thi | 95.74 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 95.69 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 95.67 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 95.63 | |
| TIGR03017 | 444 | EpsF chain length determinant protein EpsF. Sequen | 95.61 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 95.55 | |
| KOG1003 | 205 | consensus Actin filament-coating protein tropomyos | 95.54 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 95.54 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 95.53 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 95.51 | |
| PRK10476 | 346 | multidrug resistance protein MdtN; Provisional | 95.5 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 95.49 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 95.48 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 95.39 | |
| PF12329 | 74 | TMF_DNA_bd: TATA element modulatory factor 1 DNA b | 95.38 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 95.35 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 95.3 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 95.28 | |
| PF06818 | 202 | Fez1: Fez1; InterPro: IPR009638 This family repres | 95.26 | |
| KOG0999 | 772 | consensus Microtubule-associated protein Bicaudal- | 95.25 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 95.23 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 95.21 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 95.2 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 95.12 | |
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 95.1 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 95.1 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 95.1 | |
| PF13166 | 712 | AAA_13: AAA domain | 95.08 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 95.07 | |
| PF04582 | 326 | Reo_sigmaC: Reovirus sigma C capsid protein; Inter | 95.04 | |
| PRK10361 | 475 | DNA recombination protein RmuC; Provisional | 95.03 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 95.02 | |
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 94.96 | |
| KOG1899 | 861 | consensus LAR transmembrane tyrosine phosphatase-i | 94.96 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 94.93 | |
| TIGR02977 | 219 | phageshock_pspA phage shock protein A. Members of | 94.89 | |
| PF14915 | 305 | CCDC144C: CCDC144C protein coiled-coil region | 94.85 | |
| COG1842 | 225 | PspA Phage shock protein A (IM30), suppresses sigm | 94.84 | |
| PF14362 | 301 | DUF4407: Domain of unknown function (DUF4407) | 94.84 | |
| PF09304 | 107 | Cortex-I_coil: Cortexillin I, coiled coil; InterPr | 94.82 | |
| PF05483 | 786 | SCP-1: Synaptonemal complex protein 1 (SCP-1); Int | 94.76 | |
| KOG1937 | 521 | consensus Uncharacterized conserved protein [Funct | 94.7 | |
| PF06818 | 202 | Fez1: Fez1; InterPro: IPR009638 This family repres | 94.65 | |
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 94.61 | |
| PF06785 | 401 | UPF0242: Uncharacterised protein family (UPF0242); | 94.61 | |
| TIGR03319 | 514 | YmdA_YtgF conserved hypothetical protein YmdA/YtgF | 94.6 | |
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 94.58 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 94.57 | |
| TIGR00998 | 334 | 8a0101 efflux pump membrane protein (multidrug res | 94.54 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 94.53 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 94.48 | |
| PF13514 | 1111 | AAA_27: AAA domain | 94.43 | |
| TIGR03017 | 444 | EpsF chain length determinant protein EpsF. Sequen | 94.43 | |
| PF05335 | 188 | DUF745: Protein of unknown function (DUF745); Inte | 94.35 | |
| KOG1937 | 521 | consensus Uncharacterized conserved protein [Funct | 94.28 | |
| PF05010 | 207 | TACC: Transforming acidic coiled-coil-containing p | 94.27 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 94.18 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 94.16 | |
| KOG0243 | 1041 | consensus Kinesin-like protein [Cytoskeleton] | 94.13 | |
| PF13166 | 712 | AAA_13: AAA domain | 94.09 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 94.01 | |
| TIGR03794 | 421 | NHPM_micro_HlyD NHPM bacteriocin system secretion | 94.01 | |
| COG4477 | 570 | EzrA Negative regulator of septation ring formatio | 94.0 | |
| PRK10698 | 222 | phage shock protein PspA; Provisional | 93.92 | |
| COG1382 | 119 | GimC Prefoldin, chaperonin cofactor [Posttranslati | 93.91 | |
| PRK03947 | 140 | prefoldin subunit alpha; Reviewed | 93.75 | |
| PF05010 | 207 | TACC: Transforming acidic coiled-coil-containing p | 93.75 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 93.74 | |
| PRK00106 | 535 | hypothetical protein; Provisional | 93.71 | |
| TIGR02971 | 327 | heterocyst_DevB ABC exporter membrane fusion prote | 93.71 | |
| PRK03947 | 140 | prefoldin subunit alpha; Reviewed | 93.65 | |
| PF06008 | 264 | Laminin_I: Laminin Domain I; InterPro: IPR009254 L | 93.57 | |
| PHA03332 | 1328 | membrane glycoprotein; Provisional | 93.56 | |
| KOG0288 | 459 | consensus WD40 repeat protein TipD [General functi | 93.55 | |
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 93.48 | |
| KOG4809 | 654 | consensus Rab6 GTPase-interacting protein involved | 93.45 | |
| PF13514 | 1111 | AAA_27: AAA domain | 93.43 | |
| PF11570 | 136 | E2R135: Coiled-coil receptor-binding R-domain of c | 93.37 | |
| TIGR01010 | 362 | BexC_CtrB_KpsE polysaccharide export inner-membran | 93.35 | |
| PF05266 | 190 | DUF724: Protein of unknown function (DUF724); Inte | 93.31 | |
| PRK10869 | 553 | recombination and repair protein; Provisional | 93.31 | |
| KOG2991 | 330 | consensus Splicing regulator [RNA processing and m | 93.3 | |
| PRK12704 | 520 | phosphodiesterase; Provisional | 93.25 | |
| PF15254 | 861 | CCDC14: Coiled-coil domain-containing protein 14 | 93.25 | |
| PRK09343 | 121 | prefoldin subunit beta; Provisional | 93.15 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 93.1 | |
| KOG0999 | 772 | consensus Microtubule-associated protein Bicaudal- | 93.01 | |
| PRK15178 | 434 | Vi polysaccharide export inner membrane protein Ve | 93.0 | |
| PRK04406 | 75 | hypothetical protein; Provisional | 92.94 | |
| COG1382 | 119 | GimC Prefoldin, chaperonin cofactor [Posttranslati | 92.91 | |
| PF02994 | 370 | Transposase_22: L1 transposable element; InterPro: | 92.87 | |
| TIGR02971 | 327 | heterocyst_DevB ABC exporter membrane fusion prote | 92.81 | |
| COG3206 | 458 | GumC Uncharacterized protein involved in exopolysa | 92.79 | |
| PF02994 | 370 | Transposase_22: L1 transposable element; InterPro: | 92.7 | |
| PF09787 | 511 | Golgin_A5: Golgin subfamily A member 5; InterPro: | 92.61 | |
| KOG2991 | 330 | consensus Splicing regulator [RNA processing and m | 92.58 | |
| KOG1962 | 216 | consensus B-cell receptor-associated protein and r | 92.55 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 92.44 | |
| TIGR02338 | 110 | gimC_beta prefoldin, beta subunit, archaeal. Chape | 92.36 | |
| KOG0239 | 670 | consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | 92.34 | |
| PRK02119 | 73 | hypothetical protein; Provisional | 92.28 | |
| PF04102 | 69 | SlyX: SlyX; InterPro: IPR007236 The SlyX protein h | 92.26 | |
| TIGR02977 | 219 | phageshock_pspA phage shock protein A. Members of | 92.21 | |
| PRK09343 | 121 | prefoldin subunit beta; Provisional | 92.2 | |
| PF12761 | 195 | End3: Actin cytoskeleton-regulatory complex protei | 92.03 | |
| PF14073 | 178 | Cep57_CLD: Centrosome localisation domain of Cep57 | 92.03 | |
| KOG4438 | 446 | consensus Centromere-associated protein NUF2 [Cell | 91.99 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 91.98 | |
| COG1842 | 225 | PspA Phage shock protein A (IM30), suppresses sigm | 91.89 | |
| PF05483 | 786 | SCP-1: Synaptonemal complex protein 1 (SCP-1); Int | 91.84 | |
| PRK00295 | 68 | hypothetical protein; Provisional | 91.82 | |
| PRK02793 | 72 | phi X174 lysis protein; Provisional | 91.8 | |
| PRK00736 | 68 | hypothetical protein; Provisional | 91.73 | |
| PF08647 | 96 | BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR01395 | 91.7 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 91.67 | |
| PRK10246 | 1047 | exonuclease subunit SbcC; Provisional | 91.61 | |
| PRK09841 | 726 | cryptic autophosphorylating protein tyrosine kinas | 91.56 | |
| PF12329 | 74 | TMF_DNA_bd: TATA element modulatory factor 1 DNA b | 91.55 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 91.54 | |
| TIGR02338 | 110 | gimC_beta prefoldin, beta subunit, archaeal. Chape | 91.51 | |
| PF09403 | 126 | FadA: Adhesion protein FadA; InterPro: IPR018543 F | 91.47 | |
| PF09728 | 309 | Taxilin: Myosin-like coiled-coil protein; InterPro | 91.46 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 91.41 | |
| PF15450 | 531 | DUF4631: Domain of unknown function (DUF4631) | 91.35 | |
| cd00632 | 105 | Prefoldin_beta Prefoldin beta; Prefoldin is a hexa | 91.31 | |
| PF08581 | 79 | Tup_N: Tup N-terminal; InterPro: IPR013890 The N-t | 91.27 | |
| cd00632 | 105 | Prefoldin_beta Prefoldin beta; Prefoldin is a hexa | 91.27 | |
| PF10805 | 106 | DUF2730: Protein of unknown function (DUF2730); In | 91.24 | |
| PRK04325 | 74 | hypothetical protein; Provisional | 91.22 | |
| PRK09841 | 726 | cryptic autophosphorylating protein tyrosine kinas | 91.06 | |
| PF05384 | 159 | DegS: Sensor protein DegS; InterPro: IPR008595 Thi | 91.04 | |
| PF15294 | 278 | Leu_zip: Leucine zipper | 91.02 | |
| PF15397 | 258 | DUF4618: Domain of unknown function (DUF4618) | 91.0 | |
| PF14915 | 305 | CCDC144C: CCDC144C protein coiled-coil region | 90.95 | |
| TIGR02231 | 525 | conserved hypothetical protein. This family consis | 90.78 | |
| COG1730 | 145 | GIM5 Predicted prefoldin, molecular chaperone impl | 90.76 | |
| PRK00846 | 77 | hypothetical protein; Provisional | 90.75 | |
| PF01442 | 202 | Apolipoprotein: Apolipoprotein A1/A4/E domain; Int | 90.6 | |
| PF05335 | 188 | DUF745: Protein of unknown function (DUF745); Inte | 90.58 | |
| PF05278 | 269 | PEARLI-4: Arabidopsis phospholipase-like protein ( | 90.46 | |
| COG3206 | 458 | GumC Uncharacterized protein involved in exopolysa | 90.41 | |
| KOG4302 | 660 | consensus Microtubule-associated protein essential | 90.4 | |
| KOG0962 | 1294 | consensus DNA repair protein RAD50, ABC-type ATPas | 90.33 | |
| PF13863 | 126 | DUF4200: Domain of unknown function (DUF4200) | 90.28 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 90.19 | |
| COG0497 | 557 | RecN ATPase involved in DNA repair [DNA replicatio | 90.18 | |
| PF04108 | 412 | APG17: Autophagy protein Apg17 ; InterPro: IPR0072 | 90.16 | |
| PF15254 | 861 | CCDC14: Coiled-coil domain-containing protein 14 | 90.12 | |
| COG1730 | 145 | GIM5 Predicted prefoldin, molecular chaperone impl | 90.11 | |
| PRK10246 | 1047 | exonuclease subunit SbcC; Provisional | 90.09 | |
| KOG0962 | 1294 | consensus DNA repair protein RAD50, ABC-type ATPas | 89.94 | |
| PF06785 | 401 | UPF0242: Uncharacterised protein family (UPF0242); | 89.93 | |
| PF10234 | 267 | Cluap1: Clusterin-associated protein-1; InterPro: | 89.82 | |
| PF15450 | 531 | DUF4631: Domain of unknown function (DUF4631) | 89.74 | |
| COG3096 | 1480 | MukB Uncharacterized protein involved in chromosom | 89.62 | |
| PF15066 | 527 | CAGE1: Cancer-associated gene protein 1 family | 89.62 | |
| PF15066 | 527 | CAGE1: Cancer-associated gene protein 1 family | 89.6 | |
| PRK03598 | 331 | putative efflux pump membrane fusion protein; Prov | 89.59 | |
| KOG4603 | 201 | consensus TBP-1 interacting protein [Signal transd | 89.56 | |
| KOG1899 | 861 | consensus LAR transmembrane tyrosine phosphatase-i | 89.51 | |
| PF10212 | 518 | TTKRSYEDQ: Predicted coiled-coil domain-containing | 89.42 | |
| PF10267 | 395 | Tmemb_cc2: Predicted transmembrane and coiled-coil | 89.33 | |
| TIGR01010 | 362 | BexC_CtrB_KpsE polysaccharide export inner-membran | 89.25 | |
| PF14282 | 106 | FlxA: FlxA-like protein | 88.97 | |
| PF12777 | 344 | MT: Microtubule-binding stalk of dynein motor; Int | 88.93 | |
| KOG0239 | 670 | consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | 88.9 | |
| PF04375 | 372 | HemX: HemX; InterPro: IPR007470 The majority of pr | 88.78 | |
| PF03962 | 188 | Mnd1: Mnd1 family; InterPro: IPR005647 This family | 88.73 | |
| PRK11519 | 719 | tyrosine kinase; Provisional | 88.63 | |
| KOG0249 | 916 | consensus LAR-interacting protein and related prot | 88.62 | |
| COG3352 | 157 | FlaC Putative archaeal flagellar protein C [Cell m | 88.48 | |
| PF14282 | 106 | FlxA: FlxA-like protein | 88.38 | |
| KOG4460 | 741 | consensus Nuclear pore complex, Nup88/rNup84 compo | 88.32 | |
| TIGR03794 | 421 | NHPM_micro_HlyD NHPM bacteriocin system secretion | 88.22 | |
| PF03148 | 384 | Tektin: Tektin family; InterPro: IPR000435 Tektin | 88.13 | |
| PF08172 | 248 | CASP_C: CASP C terminal; InterPro: IPR012955 This | 88.02 | |
| PF14197 | 69 | Cep57_CLD_2: Centrosome localisation domain of PPC | 87.9 | |
| KOG0982 | 502 | consensus Centrosomal protein Nuf [Cell cycle cont | 87.86 | |
| TIGR03495 | 135 | phage_LysB phage lysis regulatory protein, LysB fa | 87.81 | |
| PRK04406 | 75 | hypothetical protein; Provisional | 87.5 | |
| KOG2264 | 907 | consensus Exostosin EXT1L [Signal transduction mec | 87.43 | |
| KOG2077 | 832 | consensus JNK/SAPK-associated protein-1 [Signal tr | 87.4 | |
| PF10211 | 189 | Ax_dynein_light: Axonemal dynein light chain; Inte | 87.36 | |
| PRK14011 | 144 | prefoldin subunit alpha; Provisional | 87.32 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 87.31 | |
| PF04912 | 388 | Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamit | 87.13 | |
| PRK15396 | 78 | murein lipoprotein; Provisional | 87.08 | |
| PRK10476 | 346 | multidrug resistance protein MdtN; Provisional | 87.07 | |
| PRK11519 | 719 | tyrosine kinase; Provisional | 87.06 | |
| PF02403 | 108 | Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom | 87.02 | |
| PRK15422 | 79 | septal ring assembly protein ZapB; Provisional | 86.97 | |
| PF15290 | 305 | Syntaphilin: Golgi-localised syntaxin-1-binding cl | 86.89 | |
| PRK11546 | 143 | zraP zinc resistance protein; Provisional | 86.84 | |
| PF06120 | 301 | Phage_HK97_TLTM: Tail length tape measure protein; | 86.82 | |
| TIGR00293 | 126 | prefoldin, archaeal alpha subunit/eukaryotic subun | 86.82 | |
| PF07889 | 126 | DUF1664: Protein of unknown function (DUF1664); In | 86.72 | |
| PF03962 | 188 | Mnd1: Mnd1 family; InterPro: IPR005647 This family | 86.54 | |
| cd00584 | 129 | Prefoldin_alpha Prefoldin alpha subunit; Prefoldin | 86.47 | |
| TIGR02231 | 525 | conserved hypothetical protein. This family consis | 86.47 | |
| PF10212 | 518 | TTKRSYEDQ: Predicted coiled-coil domain-containing | 86.17 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 86.07 | |
| PF07058 | 351 | Myosin_HC-like: Myosin II heavy chain-like; InterP | 86.06 | |
| KOG0288 | 459 | consensus WD40 repeat protein TipD [General functi | 86.04 | |
| KOG2264 | 907 | consensus Exostosin EXT1L [Signal transduction mec | 85.75 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 85.72 | |
| COG2900 | 72 | SlyX Uncharacterized protein conserved in bacteria | 85.68 | |
| PF07851 | 330 | TMPIT: TMPIT-like protein; InterPro: IPR012926 A n | 85.59 | |
| PF07851 | 330 | TMPIT: TMPIT-like protein; InterPro: IPR012926 A n | 85.57 | |
| PF05008 | 79 | V-SNARE: Vesicle transport v-SNARE protein N-termi | 85.53 | |
| PF14197 | 69 | Cep57_CLD_2: Centrosome localisation domain of PPC | 85.42 | |
| TIGR00998 | 334 | 8a0101 efflux pump membrane protein (multidrug res | 85.38 | |
| cd00890 | 129 | Prefoldin Prefoldin is a hexameric molecular chape | 85.36 | |
| PF01920 | 106 | Prefoldin_2: Prefoldin subunit; InterPro: IPR00277 | 85.33 | |
| PF03904 | 230 | DUF334: Domain of unknown function (DUF334); Inter | 85.18 | |
| PF05791 | 184 | Bacillus_HBL: Bacillus haemolytic enterotoxin (HBL | 85.08 | |
| PF02050 | 123 | FliJ: Flagellar FliJ protein; InterPro: IPR012823 | 84.72 | |
| PRK10869 | 553 | recombination and repair protein; Provisional | 84.67 | |
| PF13747 | 89 | DUF4164: Domain of unknown function (DUF4164) | 84.6 | |
| KOG1850 | 391 | consensus Myosin-like coiled-coil protein [Cytoske | 84.57 | |
| PF08702 | 146 | Fib_alpha: Fibrinogen alpha/beta chain family; Int | 84.54 | |
| PF01442 | 202 | Apolipoprotein: Apolipoprotein A1/A4/E domain; Int | 84.47 | |
| PF04102 | 69 | SlyX: SlyX; InterPro: IPR007236 The SlyX protein h | 84.43 | |
| cd00890 | 129 | Prefoldin Prefoldin is a hexameric molecular chape | 84.37 | |
| PF07798 | 177 | DUF1640: Protein of unknown function (DUF1640); In | 84.07 | |
| PF06103 | 90 | DUF948: Bacterial protein of unknown function (DUF | 84.0 | |
| PRK02119 | 73 | hypothetical protein; Provisional | 83.95 | |
| PF14362 | 301 | DUF4407: Domain of unknown function (DUF4407) | 83.87 | |
| KOG0982 | 502 | consensus Centrosomal protein Nuf [Cell cycle cont | 83.77 | |
| PF06248 | 593 | Zw10: Centromere/kinetochore Zw10; InterPro: IPR00 | 83.75 | |
| PF02403 | 108 | Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom | 83.72 | |
| PRK00409 | 782 | recombination and DNA strand exchange inhibitor pr | 83.56 | |
| PF13747 | 89 | DUF4164: Domain of unknown function (DUF4164) | 83.52 | |
| PF11570 | 136 | E2R135: Coiled-coil receptor-binding R-domain of c | 83.52 | |
| TIGR00293 | 126 | prefoldin, archaeal alpha subunit/eukaryotic subun | 83.45 | |
| PF10267 | 395 | Tmemb_cc2: Predicted transmembrane and coiled-coil | 83.37 | |
| PF10205 | 102 | KLRAQ: Predicted coiled-coil domain-containing pro | 83.37 | |
| PF15456 | 124 | Uds1: Up-regulated During Septation | 83.3 | |
| PF03904 | 230 | DUF334: Domain of unknown function (DUF334); Inter | 83.28 | |
| PF09738 | 302 | DUF2051: Double stranded RNA binding protein (DUF2 | 83.2 | |
| PF06705 | 247 | SF-assemblin: SF-assemblin/beta giardin | 83.15 | |
| PF05546 | 207 | She9_MDM33: She9 / Mdm33 family; InterPro: IPR0088 | 83.14 | |
| PF15290 | 305 | Syntaphilin: Golgi-localised syntaxin-1-binding cl | 83.11 | |
| KOG4302 | 660 | consensus Microtubule-associated protein essential | 83.07 | |
| PF06810 | 155 | Phage_GP20: Phage minor structural protein GP20; I | 83.03 | |
| PF06476 | 115 | DUF1090: Protein of unknown function (DUF1090); In | 83.02 | |
| PF06248 | 593 | Zw10: Centromere/kinetochore Zw10; InterPro: IPR00 | 83.01 | |
| PF07989 | 75 | Microtub_assoc: Microtubule associated; InterPro: | 82.76 | |
| KOG2685 | 421 | consensus Cystoskeletal protein Tektin [Cytoskelet | 82.75 | |
| PF07989 | 75 | Microtub_assoc: Microtubule associated; InterPro: | 82.46 | |
| PF15294 | 278 | Leu_zip: Leucine zipper | 82.35 | |
| KOG0998 | 847 | consensus Synaptic vesicle protein EHS-1 and relat | 82.33 | |
| KOG4593 | 716 | consensus Mitotic checkpoint protein MAD1 [Cell cy | 82.29 | |
| TIGR03752 | 472 | conj_TIGR03752 integrating conjugative element pro | 82.23 | |
| COG4477 | 570 | EzrA Negative regulator of septation ring formatio | 82.19 | |
| COG4487 | 438 | Uncharacterized protein conserved in bacteria [Fun | 82.15 | |
| COG3074 | 79 | Uncharacterized protein conserved in bacteria [Fun | 82.13 | |
| PRK04325 | 74 | hypothetical protein; Provisional | 81.97 | |
| PF04871 | 136 | Uso1_p115_C: Uso1 / p115 like vesicle tethering pr | 81.88 | |
| PRK00295 | 68 | hypothetical protein; Provisional | 81.86 | |
| TIGR01069 | 771 | mutS2 MutS2 family protein. Function of MutS2 is u | 81.84 | |
| PF07111 | 739 | HCR: Alpha helical coiled-coil rod protein (HCR); | 81.82 | |
| PF08172 | 248 | CASP_C: CASP C terminal; InterPro: IPR012955 This | 81.76 | |
| PF09486 | 158 | HrpB7: Bacterial type III secretion protein (HrpB7 | 81.73 | |
| PRK11020 | 118 | hypothetical protein; Provisional | 81.54 | |
| KOG0240 | 607 | consensus Kinesin (SMY1 subfamily) [Cytoskeleton] | 81.27 | |
| PRK14011 | 144 | prefoldin subunit alpha; Provisional | 81.25 | |
| KOG2391 | 365 | consensus Vacuolar sorting protein/ubiquitin recep | 81.19 | |
| PF05529 | 192 | Bap31: B-cell receptor-associated protein 31-like | 81.1 | |
| PF10458 | 66 | Val_tRNA-synt_C: Valyl tRNA synthetase tRNA bindin | 80.9 | |
| PRK06975 | 656 | bifunctional uroporphyrinogen-III synthetase/uropo | 80.89 | |
| KOG2751 | 447 | consensus Beclin-like protein [Signal transduction | 80.85 | |
| PLN03229 | 762 | acetyl-coenzyme A carboxylase carboxyl transferase | 80.83 | |
| PF09731 | 582 | Mitofilin: Mitochondrial inner membrane protein; I | 80.82 | |
| smart00806 | 426 | AIP3 Actin interacting protein 3. Aip3p/Bud6p is a | 80.81 | |
| PRK00286 | 438 | xseA exodeoxyribonuclease VII large subunit; Revie | 80.71 | |
| PF11180 | 192 | DUF2968: Protein of unknown function (DUF2968); In | 80.55 | |
| PF10368 | 204 | YkyA: Putative cell-wall binding lipoprotein; Inte | 80.23 | |
| PF05103 | 131 | DivIVA: DivIVA protein; InterPro: IPR007793 The Ba | 80.09 | |
| PRK10361 | 475 | DNA recombination protein RmuC; Provisional | 80.02 |
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
Probab=99.20 E-value=1.2e-08 Score=107.40 Aligned_cols=64 Identities=11% Similarity=0.120 Sum_probs=35.1
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 013360 130 KESEKQQKEKEALEARAIEAEKKISDLSAKLEKLQKINDEQKSKIRKTERALKVAEEEMMRAKF 193 (444)
Q Consensus 130 kelE~~~~e~~~LEae~~elEkkleEle~kveeLe~~~eeqekqI~elE~~Lq~~Eeel~kak~ 193 (444)
..+..++..+.+++.+..+++....+.+..+..|+....+++..+.+++...+.++..|.+++.
T Consensus 191 ~~~~~l~~~~~e~~~~k~~L~~~k~e~~~~l~~L~~~~~~~~~~l~~l~~~~~~L~~~I~~l~~ 254 (428)
T PRK11637 191 EKQSQQKTLLYEQQAQQQKLEQARNERKKTLTGLESSLQKDQQQLSELRANESRLRDSIARAER 254 (428)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 3333333444444455555555555555555556666666666666666666666666655443
|
|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >KOG0243 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF12795 MscS_porin: Mechanosensitive ion channel porin domain | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12795 MscS_porin: Mechanosensitive ion channel porin domain | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK10929 putative mechanosensitive channel protein; Provisional | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF13870 DUF4201: Domain of unknown function (DUF4201) | Back alignment and domain information |
|---|
| >KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >PRK10929 putative mechanosensitive channel protein; Provisional | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells | Back alignment and domain information |
|---|
| >PF04582 Reo_sigmaC: Reovirus sigma C capsid protein; InterPro: IPR007662 Protein sigmaC in its native state was shown to be a homotrimer | Back alignment and domain information |
|---|
| >PF15397 DUF4618: Domain of unknown function (DUF4618) | Back alignment and domain information |
|---|
| >PF13870 DUF4201: Domain of unknown function (DUF4201) | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >TIGR03017 EpsF chain length determinant protein EpsF | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10476 multidrug resistance protein MdtN; Provisional | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein | Back alignment and domain information |
|---|
| >KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >PF13166 AAA_13: AAA domain | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF04582 Reo_sigmaC: Reovirus sigma C capsid protein; InterPro: IPR007662 Protein sigmaC in its native state was shown to be a homotrimer | Back alignment and domain information |
|---|
| >PRK10361 DNA recombination protein RmuC; Provisional | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR02977 phageshock_pspA phage shock protein A | Back alignment and domain information |
|---|
| >PF14915 CCDC144C: CCDC144C protein coiled-coil region | Back alignment and domain information |
|---|
| >COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14362 DUF4407: Domain of unknown function (DUF4407) | Back alignment and domain information |
|---|
| >PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) | Back alignment and domain information |
|---|
| >PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex | Back alignment and domain information |
|---|
| >KOG1937 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function | Back alignment and domain information |
|---|
| >TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >TIGR03017 EpsF chain length determinant protein EpsF | Back alignment and domain information |
|---|
| >PF05335 DUF745: Protein of unknown function (DUF745); InterPro: IPR007999 This family consists of several uncharacterised Drosophila melanogaster proteins of unknown function | Back alignment and domain information |
|---|
| >KOG1937 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >KOG0243 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF13166 AAA_13: AAA domain | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein | Back alignment and domain information |
|---|
| >COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK10698 phage shock protein PspA; Provisional | Back alignment and domain information |
|---|
| >COG1382 GimC Prefoldin, chaperonin cofactor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK03947 prefoldin subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >PRK00106 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family | Back alignment and domain information |
|---|
| >PRK03947 prefoldin subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells | Back alignment and domain information |
|---|
| >PHA03332 membrane glycoprotein; Provisional | Back alignment and domain information |
|---|
| >KOG0288 consensus WD40 repeat protein TipD [General function prediction only] | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >KOG4809 consensus Rab6 GTPase-interacting protein involved in endosome-to-TGN transport [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >PF11570 E2R135: Coiled-coil receptor-binding R-domain of colicin E2; InterPro: IPR024566 Bacteriocins are protein antibiotics that kill bacteria closely related to the producing species | Back alignment and domain information |
|---|
| >TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family | Back alignment and domain information |
|---|
| >PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana | Back alignment and domain information |
|---|
| >PRK10869 recombination and repair protein; Provisional | Back alignment and domain information |
|---|
| >KOG2991 consensus Splicing regulator [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK12704 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >PF15254 CCDC14: Coiled-coil domain-containing protein 14 | Back alignment and domain information |
|---|
| >PRK09343 prefoldin subunit beta; Provisional | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK15178 Vi polysaccharide export inner membrane protein VexD; Provisional | Back alignment and domain information |
|---|
| >PRK04406 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1382 GimC Prefoldin, chaperonin cofactor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF02994 Transposase_22: L1 transposable element; InterPro: IPR004244 Many human L1 elements are capable of retrotransposition | Back alignment and domain information |
|---|
| >TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family | Back alignment and domain information |
|---|
| >COG3206 GumC Uncharacterized protein involved in exopolysaccharide biosynthesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PF02994 Transposase_22: L1 transposable element; InterPro: IPR004244 Many human L1 elements are capable of retrotransposition | Back alignment and domain information |
|---|
| >PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure | Back alignment and domain information |
|---|
| >KOG2991 consensus Splicing regulator [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >TIGR02338 gimC_beta prefoldin, beta subunit, archaeal | Back alignment and domain information |
|---|
| >KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK02119 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function | Back alignment and domain information |
|---|
| >TIGR02977 phageshock_pspA phage shock protein A | Back alignment and domain information |
|---|
| >PRK09343 prefoldin subunit beta; Provisional | Back alignment and domain information |
|---|
| >PF12761 End3: Actin cytoskeleton-regulatory complex protein END3 | Back alignment and domain information |
|---|
| >PF14073 Cep57_CLD: Centrosome localisation domain of Cep57 | Back alignment and domain information |
|---|
| >KOG4438 consensus Centromere-associated protein NUF2 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex | Back alignment and domain information |
|---|
| >PRK00295 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK02793 phi X174 lysis protein; Provisional | Back alignment and domain information |
|---|
| >PRK00736 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF08647 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR013956 BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions [] | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10246 exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional | Back alignment and domain information |
|---|
| >PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02338 gimC_beta prefoldin, beta subunit, archaeal | Back alignment and domain information |
|---|
| >PF09403 FadA: Adhesion protein FadA; InterPro: IPR018543 FadA (Fusobacterium adhesin A) is an adhesin which forms two alpha helices | Back alignment and domain information |
|---|
| >PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >PF15450 DUF4631: Domain of unknown function (DUF4631) | Back alignment and domain information |
|---|
| >cd00632 Prefoldin_beta Prefoldin beta; Prefoldin is a hexameric molecular chaperone complex, composed of two evolutionarily related subunits (alpha and beta), which are found in both eukaryotes and archaea | Back alignment and domain information |
|---|
| >PF08581 Tup_N: Tup N-terminal; InterPro: IPR013890 The N-terminal region of the Tup protein has been shown to interact with the Ssn6 transcriptional co-repressor [] | Back alignment and domain information |
|---|
| >cd00632 Prefoldin_beta Prefoldin beta; Prefoldin is a hexameric molecular chaperone complex, composed of two evolutionarily related subunits (alpha and beta), which are found in both eukaryotes and archaea | Back alignment and domain information |
|---|
| >PF10805 DUF2730: Protein of unknown function (DUF2730); InterPro: IPR020269 This entry represents a family of various hypothetical proteins | Back alignment and domain information |
|---|
| >PRK04325 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional | Back alignment and domain information |
|---|
| >PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins | Back alignment and domain information |
|---|
| >PF15294 Leu_zip: Leucine zipper | Back alignment and domain information |
|---|
| >PF15397 DUF4618: Domain of unknown function (DUF4618) | Back alignment and domain information |
|---|
| >PF14915 CCDC144C: CCDC144C protein coiled-coil region | Back alignment and domain information |
|---|
| >TIGR02231 conserved hypothetical protein | Back alignment and domain information |
|---|
| >COG1730 GIM5 Predicted prefoldin, molecular chaperone implicated in de novo protein folding [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK00846 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF01442 Apolipoprotein: Apolipoprotein A1/A4/E domain; InterPro: IPR000074 Exchangeable apolipoproteins (apoA, apoC and apoE) have the same genomic structure and are members of a multi-gene family that probably evolved from a common ancestral gene | Back alignment and domain information |
|---|
| >PF05335 DUF745: Protein of unknown function (DUF745); InterPro: IPR007999 This family consists of several uncharacterised Drosophila melanogaster proteins of unknown function | Back alignment and domain information |
|---|
| >PF05278 PEARLI-4: Arabidopsis phospholipase-like protein (PEARLI 4); InterPro: IPR007942 This family contains several phospholipase-like proteins from Arabidopsis thaliana and other members of the Streptophyta which are homologous to PEARLI 4 | Back alignment and domain information |
|---|
| >COG3206 GumC Uncharacterized protein involved in exopolysaccharide biosynthesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >KOG4302 consensus Microtubule-associated protein essential for anaphase spindle elongation [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF13863 DUF4200: Domain of unknown function (DUF4200) | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF04108 APG17: Autophagy protein Apg17 ; InterPro: IPR007240 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF15254 CCDC14: Coiled-coil domain-containing protein 14 | Back alignment and domain information |
|---|
| >COG1730 GIM5 Predicted prefoldin, molecular chaperone implicated in de novo protein folding [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10246 exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function | Back alignment and domain information |
|---|
| >PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin | Back alignment and domain information |
|---|
| >PF15450 DUF4631: Domain of unknown function (DUF4631) | Back alignment and domain information |
|---|
| >COG3096 MukB Uncharacterized protein involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF15066 CAGE1: Cancer-associated gene protein 1 family | Back alignment and domain information |
|---|
| >PF15066 CAGE1: Cancer-associated gene protein 1 family | Back alignment and domain information |
|---|
| >PRK03598 putative efflux pump membrane fusion protein; Provisional | Back alignment and domain information |
|---|
| >KOG4603 consensus TBP-1 interacting protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only] | Back alignment and domain information |
|---|
| >PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif | Back alignment and domain information |
|---|
| >PF10267 Tmemb_cc2: Predicted transmembrane and coiled-coil 2 protein; InterPro: IPR019394 This family of transmembrane coiled-coil containing proteins is conserved from worms to humans | Back alignment and domain information |
|---|
| >TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family | Back alignment and domain information |
|---|
| >PF14282 FlxA: FlxA-like protein | Back alignment and domain information |
|---|
| >PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases | Back alignment and domain information |
|---|
| >KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF04375 HemX: HemX; InterPro: IPR007470 The majority of proteins in this family are annotated as uroporphyrin-III C-methyltransferase (2 | Back alignment and domain information |
|---|
| >PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) | Back alignment and domain information |
|---|
| >PRK11519 tyrosine kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >COG3352 FlaC Putative archaeal flagellar protein C [Cell motility and secretion] | Back alignment and domain information |
|---|
| >PF14282 FlxA: FlxA-like protein | Back alignment and domain information |
|---|
| >KOG4460 consensus Nuclear pore complex, Nup88/rNup84 component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein | Back alignment and domain information |
|---|
| >PF03148 Tektin: Tektin family; InterPro: IPR000435 Tektin heteropolymers form unique protofilaments of flagellar microtubules [] | Back alignment and domain information |
|---|
| >PF08172 CASP_C: CASP C terminal; InterPro: IPR012955 This domain is the C-terminal region of the CASP family of proteins | Back alignment and domain information |
|---|
| >PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 | Back alignment and domain information |
|---|
| >KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR03495 phage_LysB phage lysis regulatory protein, LysB family | Back alignment and domain information |
|---|
| >PRK04406 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2264 consensus Exostosin EXT1L [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2077 consensus JNK/SAPK-associated protein-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF10211 Ax_dynein_light: Axonemal dynein light chain; InterPro: IPR019347 Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility | Back alignment and domain information |
|---|
| >PRK14011 prefoldin subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >PF04912 Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamitin is a subunit of the microtubule-dependent motor complex, it is also implicated in cell adhesion by binding to macrophage-enriched myristoylated alanine-rice C kinase substrate (MacMARCKS) [] | Back alignment and domain information |
|---|
| >PRK15396 murein lipoprotein; Provisional | Back alignment and domain information |
|---|
| >PRK10476 multidrug resistance protein MdtN; Provisional | Back alignment and domain information |
|---|
| >PRK11519 tyrosine kinase; Provisional | Back alignment and domain information |
|---|
| >PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 | Back alignment and domain information |
|---|
| >PRK15422 septal ring assembly protein ZapB; Provisional | Back alignment and domain information |
|---|
| >PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp | Back alignment and domain information |
|---|
| >PRK11546 zraP zinc resistance protein; Provisional | Back alignment and domain information |
|---|
| >PF06120 Phage_HK97_TLTM: Tail length tape measure protein; InterPro: IPR009302 This entry consists of the tail length tape measure protein from Bacteriophage HK97 and related sequences from Escherichia coli (strain K12) | Back alignment and domain information |
|---|
| >TIGR00293 prefoldin, archaeal alpha subunit/eukaryotic subunit 5 | Back alignment and domain information |
|---|
| >PF07889 DUF1664: Protein of unknown function (DUF1664); InterPro: IPR012458 The members of this family are hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) | Back alignment and domain information |
|---|
| >cd00584 Prefoldin_alpha Prefoldin alpha subunit; Prefoldin is a hexameric molecular chaperone complex, found in both eukaryotes and archaea, that binds and stabilizes newly synthesized polypeptides allowing them to fold correctly | Back alignment and domain information |
|---|
| >TIGR02231 conserved hypothetical protein | Back alignment and domain information |
|---|
| >PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >PF07058 Myosin_HC-like: Myosin II heavy chain-like; InterPro: IPR009768 This family represents a conserved region within a number of myosin II heavy chain-like proteins that seem to be specific to Arabidopsis thaliana | Back alignment and domain information |
|---|
| >KOG0288 consensus WD40 repeat protein TipD [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2264 consensus Exostosin EXT1L [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >COG2900 SlyX Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF07851 TMPIT: TMPIT-like protein; InterPro: IPR012926 A number of members of this family are annotated as being transmembrane proteins induced by tumour necrosis factor alpha, but no literature was found to support this | Back alignment and domain information |
|---|
| >PF07851 TMPIT: TMPIT-like protein; InterPro: IPR012926 A number of members of this family are annotated as being transmembrane proteins induced by tumour necrosis factor alpha, but no literature was found to support this | Back alignment and domain information |
|---|
| >PF05008 V-SNARE: Vesicle transport v-SNARE protein N-terminus; InterPro: IPR007705 V-SNARE proteins are required for protein traffic between eukaryotic organelles | Back alignment and domain information |
|---|
| >PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 | Back alignment and domain information |
|---|
| >TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) | Back alignment and domain information |
|---|
| >cd00890 Prefoldin Prefoldin is a hexameric molecular chaperone complex, found in both eukaryotes and archaea, that binds and stabilizes newly synthesized polypeptides allowing them to fold correctly | Back alignment and domain information |
|---|
| >PF01920 Prefoldin_2: Prefoldin subunit; InterPro: IPR002777 Prefoldin (PFD) is a chaperone that interacts exclusively with type II chaperonins, hetero-oligomers lacking an obligate co-chaperonin that are found only in eukaryotes (chaperonin-containing T-complex polypeptide-1 (CCT)) and archaea | Back alignment and domain information |
|---|
| >PF03904 DUF334: Domain of unknown function (DUF334); InterPro: IPR005602 This is a family of proteins found in Staphylococcus aureus plasmid with no characterised function | Back alignment and domain information |
|---|
| >PF05791 Bacillus_HBL: Bacillus haemolytic enterotoxin (HBL); InterPro: IPR008414 This family consists of several Bacillus haemolytic enterotoxins (HblC, HblD, HblA, NheA, and NheB), which can cause food poisoning in humans [] | Back alignment and domain information |
|---|
| >PF02050 FliJ: Flagellar FliJ protein; InterPro: IPR012823 Many flagellar proteins are exported by a flagellum-specific export pathway | Back alignment and domain information |
|---|
| >PRK10869 recombination and repair protein; Provisional | Back alignment and domain information |
|---|
| >PF13747 DUF4164: Domain of unknown function (DUF4164) | Back alignment and domain information |
|---|
| >KOG1850 consensus Myosin-like coiled-coil protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF08702 Fib_alpha: Fibrinogen alpha/beta chain family; InterPro: IPR012290 Fibrinogen plays key roles in both blood clotting and platelet aggregation | Back alignment and domain information |
|---|
| >PF01442 Apolipoprotein: Apolipoprotein A1/A4/E domain; InterPro: IPR000074 Exchangeable apolipoproteins (apoA, apoC and apoE) have the same genomic structure and are members of a multi-gene family that probably evolved from a common ancestral gene | Back alignment and domain information |
|---|
| >PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function | Back alignment and domain information |
|---|
| >cd00890 Prefoldin Prefoldin is a hexameric molecular chaperone complex, found in both eukaryotes and archaea, that binds and stabilizes newly synthesized polypeptides allowing them to fold correctly | Back alignment and domain information |
|---|
| >PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins | Back alignment and domain information |
|---|
| >PF06103 DUF948: Bacterial protein of unknown function (DUF948); InterPro: IPR009293 This family consists of bacterial sequences several of which are thought to be general stress proteins | Back alignment and domain information |
|---|
| >PRK02119 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF14362 DUF4407: Domain of unknown function (DUF4407) | Back alignment and domain information |
|---|
| >KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF06248 Zw10: Centromere/kinetochore Zw10; InterPro: IPR009361 Zeste white 10 (ZW10) was initially identified as a mitotic checkpoint protein involved in chromosome segregation, and then implicated in targeting cytoplasmic dynein and dynactin to mitotic kinetochores, but it is also important in non-dividing cells | Back alignment and domain information |
|---|
| >PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 | Back alignment and domain information |
|---|
| >PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >PF13747 DUF4164: Domain of unknown function (DUF4164) | Back alignment and domain information |
|---|
| >PF11570 E2R135: Coiled-coil receptor-binding R-domain of colicin E2; InterPro: IPR024566 Bacteriocins are protein antibiotics that kill bacteria closely related to the producing species | Back alignment and domain information |
|---|
| >TIGR00293 prefoldin, archaeal alpha subunit/eukaryotic subunit 5 | Back alignment and domain information |
|---|
| >PF10267 Tmemb_cc2: Predicted transmembrane and coiled-coil 2 protein; InterPro: IPR019394 This family of transmembrane coiled-coil containing proteins is conserved from worms to humans | Back alignment and domain information |
|---|
| >PF10205 KLRAQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019343 This entry represents a N-terminal 100 residues long domain, which contains a conserved KLRAQ motif | Back alignment and domain information |
|---|
| >PF15456 Uds1: Up-regulated During Septation | Back alignment and domain information |
|---|
| >PF03904 DUF334: Domain of unknown function (DUF334); InterPro: IPR005602 This is a family of proteins found in Staphylococcus aureus plasmid with no characterised function | Back alignment and domain information |
|---|
| >PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA | Back alignment and domain information |
|---|
| >PF06705 SF-assemblin: SF-assemblin/beta giardin | Back alignment and domain information |
|---|
| >PF05546 She9_MDM33: She9 / Mdm33 family; InterPro: IPR008839 Members of this family are mitochondrial inner membrane proteins with a role in inner mitochondrial membrane organisation and biogenesis [] | Back alignment and domain information |
|---|
| >PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp | Back alignment and domain information |
|---|
| >KOG4302 consensus Microtubule-associated protein essential for anaphase spindle elongation [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF06810 Phage_GP20: Phage minor structural protein GP20; InterPro: IPR009636 This family consists of several phage minor structural protein Gp20 sequences and prophage sequences of around 180 residues in length | Back alignment and domain information |
|---|
| >PF06476 DUF1090: Protein of unknown function (DUF1090); InterPro: IPR009468 This family consists of several bacterial proteins of unknown function and is known as YqjC in Escherichia coli | Back alignment and domain information |
|---|
| >PF06248 Zw10: Centromere/kinetochore Zw10; InterPro: IPR009361 Zeste white 10 (ZW10) was initially identified as a mitotic checkpoint protein involved in chromosome segregation, and then implicated in targeting cytoplasmic dynein and dynactin to mitotic kinetochores, but it is also important in non-dividing cells | Back alignment and domain information |
|---|
| >PF07989 Microtub_assoc: Microtubule associated; InterPro: IPR012943 Proteins with this domain associate with the spindle body during cell division [] | Back alignment and domain information |
|---|
| >KOG2685 consensus Cystoskeletal protein Tektin [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF07989 Microtub_assoc: Microtubule associated; InterPro: IPR012943 Proteins with this domain associate with the spindle body during cell division [] | Back alignment and domain information |
|---|
| >PF15294 Leu_zip: Leucine zipper | Back alignment and domain information |
|---|
| >KOG0998 consensus Synaptic vesicle protein EHS-1 and related EH domain proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family | Back alignment and domain information |
|---|
| >COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >COG4487 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >COG3074 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK04325 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF04871 Uso1_p115_C: Uso1 / p115 like vesicle tethering protein, C terminal region; InterPro: IPR006955 This domain identifies a group of proteins, which are described as: General vesicular transport factor, Transcytosis associate protein (TAP) and Vesicle docking protein | Back alignment and domain information |
|---|
| >PRK00295 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01069 mutS2 MutS2 family protein | Back alignment and domain information |
|---|
| >PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins | Back alignment and domain information |
|---|
| >PF08172 CASP_C: CASP C terminal; InterPro: IPR012955 This domain is the C-terminal region of the CASP family of proteins | Back alignment and domain information |
|---|
| >PF09486 HrpB7: Bacterial type III secretion protein (HrpB7); InterPro: IPR013392 This entry represents proteins encoded by genes which are found in type III secretion operons in a narrow range of species including Xanthomonas, Burkholderia and Ralstonia | Back alignment and domain information |
|---|
| >PRK11020 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0240 consensus Kinesin (SMY1 subfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK14011 prefoldin subunit alpha; Provisional | Back alignment and domain information |
|---|
| >KOG2391 consensus Vacuolar sorting protein/ubiquitin receptor VPS23 [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF05529 Bap31: B-cell receptor-associated protein 31-like ; InterPro: IPR008417 Bap31 is a polytopic integral protein of the endoplasmic reticulum membrane and a substrate of caspase-8 | Back alignment and domain information |
|---|
| >PF10458 Val_tRNA-synt_C: Valyl tRNA synthetase tRNA binding arm; InterPro: IPR019499 The aminoacyl-tRNA synthetases (6 | Back alignment and domain information |
|---|
| >PRK06975 bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >KOG2751 consensus Beclin-like protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PF09731 Mitofilin: Mitochondrial inner membrane protein; InterPro: IPR019133 Mitofilin controls mitochondrial cristae morphology | Back alignment and domain information |
|---|
| >smart00806 AIP3 Actin interacting protein 3 | Back alignment and domain information |
|---|
| >PRK00286 xseA exodeoxyribonuclease VII large subunit; Reviewed | Back alignment and domain information |
|---|
| >PF11180 DUF2968: Protein of unknown function (DUF2968); InterPro: IPR021350 This family of proteins has no known function | Back alignment and domain information |
|---|
| >PF10368 YkyA: Putative cell-wall binding lipoprotein; InterPro: IPR019454 The YkyA family of proteins contain a lipoprotein signal and a hydrolase domain | Back alignment and domain information |
|---|
| >PF05103 DivIVA: DivIVA protein; InterPro: IPR007793 The Bacillus subtilis divIVA1 mutation causes misplacement of the septum during cell division, resulting in the formation of small, circular, anucleate minicells [] | Back alignment and domain information |
|---|
| >PRK10361 DNA recombination protein RmuC; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 444 | |||
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 7e-15 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 5e-11 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 8e-11 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 1e-09 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 4e-07 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 3e-04 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 7e-13 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 3e-12 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 1e-11 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-11 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-11 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 7e-11 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 9e-11 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-10 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 5e-10 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 9e-09 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 5e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-08 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 3e-07 | |
| 1w1w_A | 430 | Structural maintenance of chromosome 1; cohesin, c | 3e-05 | |
| 2xs1_A | 704 | Programmed cell death 6-interacting protein; prote | 3e-05 | |
| 2zuo_A | 861 | MVP, major vault protein; repeat domains, protein- | 4e-05 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 4e-05 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 5e-05 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 6e-05 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 8e-05 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 1e-04 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 3e-04 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 6e-04 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 1e-04 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 2e-04 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 1e-04 |
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
Score = 76.3 bits (188), Expect = 7e-15
Identities = 35/160 (21%), Positives = 69/160 (43%), Gaps = 8/160 (5%)
Query: 43 LKIELDQLKSKIRSLESHIDEKTQELKGKDEVVAQKEKAIQDKSERIVSLQKELSSLQKK 102
K L++KI L+ IDE+ +E K ++ + S L+ ++ L+
Sbjct: 919 YKKLHIGLENKIMQLQRKIDEQNKEYK---SLLEKMNNLEITYSTETEKLRSDVERLRMS 975
Query: 103 ETLNAAEQVDKAHARADELEKQIDNLKKESEKQQKEKEALEARAIEAEKKISDLSAKLEK 162
E E+ A R L+++I L+KE + Q EK+ +E A + + + L ++L++
Sbjct: 976 E-----EEAKNATNRVLSLQEEIAKLRKELHQTQTEKKTIEEWADKYKHETEQLVSELKE 1030
Query: 163 LQKINDEQKSKIRKTERALKVAEEEMMRAKFEATSRSKEL 202
+ +K ++ + E M K ++ EL
Sbjct: 1031 QNTLLKTEKEELNRRIHDQAKEITETMEKKLVEETKQLEL 1070
|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Length = 256 | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Length = 256 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Length = 430 | Back alignment and structure |
|---|
| >2xs1_A Programmed cell death 6-interacting protein; protein transport-viral protein complex, cell cycle; 2.30A {Homo sapiens} PDB: 2xs8_A 2oev_A 2r05_A 2r02_A 2r03_A 2oex_A 2ojq_A Length = 704 | Back alignment and structure |
|---|
| >2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Length = 189 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Length = 854 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 444 | |||
| 2a01_A | 243 | Apolipoprotein A-I; four-helix bundle, lipid trans | 99.16 | |
| 3s84_A | 273 | Apolipoprotein A-IV; four helix bundle, transport | 98.82 | |
| 3s84_A | 273 | Apolipoprotein A-IV; four helix bundle, transport | 98.81 | |
| 2a01_A | 243 | Apolipoprotein A-I; four-helix bundle, lipid trans | 98.76 | |
| 1nfn_A | 191 | Apolipoprotein E3; lipid transport, heparin-bindin | 98.67 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 98.66 | |
| 2lem_A | 216 | Apolipoprotein A-I; lipid transport; NMR {Mus musc | 98.66 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 98.64 | |
| 1nfn_A | 191 | Apolipoprotein E3; lipid transport, heparin-bindin | 98.62 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 98.61 | |
| 2lem_A | 216 | Apolipoprotein A-I; lipid transport; NMR {Mus musc | 98.55 | |
| 3r2p_A | 185 | Apolipoprotein A-I; amphipathic alpha-helix, major | 98.53 | |
| 3r2p_A | 185 | Apolipoprotein A-I; amphipathic alpha-helix, major | 98.52 | |
| 1gs9_A | 165 | Apolipoprotein E, APOE4; lipid transport, heparin- | 98.41 | |
| 2l7b_A | 307 | Apolipoprotein E, APO-E; lipid transport, atherosc | 98.33 | |
| 2l7b_A | 307 | Apolipoprotein E, APO-E; lipid transport, atherosc | 98.32 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 98.31 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 98.0 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 97.98 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 97.91 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 97.9 | |
| 1gs9_A | 165 | Apolipoprotein E, APOE4; lipid transport, heparin- | 97.73 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 97.68 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 97.58 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 97.55 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 97.5 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 97.43 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 97.39 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 97.32 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 97.27 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 97.25 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 97.22 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 97.17 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 97.15 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 97.14 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 97.05 | |
| 4gkw_A | 167 | Spindle assembly abnormal protein 6; double helix, | 96.21 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 96.07 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 96.03 | |
| 2eqb_B | 97 | RAB guanine nucleotide exchange factor SEC2; coile | 95.95 | |
| 3tnu_A | 131 | Keratin, type I cytoskeletal 14; coiled-coil, stru | 95.92 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 95.92 | |
| 3tnu_A | 131 | Keratin, type I cytoskeletal 14; coiled-coil, stru | 95.75 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 95.75 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 95.48 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 95.47 | |
| 2b9c_A | 147 | Striated-muscle alpha tropomyosin; alpha-helix, co | 95.42 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 95.29 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 95.15 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 95.14 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 94.93 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 94.8 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 94.8 | |
| 2b9c_A | 147 | Striated-muscle alpha tropomyosin; alpha-helix, co | 94.78 | |
| 2v4h_A | 110 | NF-kappa-B essential modulator; transcription, met | 94.58 | |
| 1l8d_A | 112 | DNA double-strand break repair RAD50 ATPase; zinc | 94.5 | |
| 2xzr_A | 114 | Immunoglobulin-binding protein EIBD; cell adhesion | 94.45 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 94.42 | |
| 3nmd_A | 72 | CGMP dependent protein kinase; leucine zipper, coi | 94.4 | |
| 2oto_A | 155 | M protein; helical coiled coil, fibrinogen-binding | 94.32 | |
| 2e7s_A | 135 | RAB guanine nucleotide exchange factor SEC2; coile | 94.25 | |
| 1m1j_B | 464 | Fibrinogen beta chain; coiled coils, disulfide rin | 94.24 | |
| 2v66_B | 111 | Nuclear distribution protein NUDE-like 1; structur | 94.14 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 93.87 | |
| 2eqb_B | 97 | RAB guanine nucleotide exchange factor SEC2; coile | 93.65 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 93.33 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 93.32 | |
| 3a7p_A | 152 | Autophagy protein 16; coiled-coil, coiled coil, cy | 93.29 | |
| 2e7s_A | 135 | RAB guanine nucleotide exchange factor SEC2; coile | 93.19 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 93.13 | |
| 1l8d_A | 112 | DNA double-strand break repair RAD50 ATPase; zinc | 93.1 | |
| 3a7p_A | 152 | Autophagy protein 16; coiled-coil, coiled coil, cy | 93.08 | |
| 2zqm_A | 117 | Prefoldin beta subunit 1; chaperone; HET: CIT; 1.9 | 92.59 | |
| 3qh9_A | 81 | Liprin-beta-2; coiled-coil, dimerization, structur | 92.25 | |
| 3q8t_A | 96 | Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 | 91.99 | |
| 3mq9_A | 471 | Bone marrow stromal antigen 2 fused to maltose-BI | 91.89 | |
| 3s4r_A | 93 | Vimentin; alpha-helix, cytoskeleton, intermediate | 91.86 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 91.81 | |
| 2v66_B | 111 | Nuclear distribution protein NUDE-like 1; structur | 91.78 | |
| 3nmd_A | 72 | CGMP dependent protein kinase; leucine zipper, coi | 91.68 | |
| 2w83_C | 77 | C-JUN-amino-terminal kinase-interacting protein 4; | 91.67 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 91.67 | |
| 3swk_A | 86 | Vimentin; cytoskeleton, intermediate filament, alp | 91.43 | |
| 3efg_A | 78 | Protein SLYX homolog; xanthomonas campestris PV. c | 91.28 | |
| 3jsv_C | 94 | NF-kappa-B essential modulator; ubiquitin, coiled- | 91.23 | |
| 2oto_A | 155 | M protein; helical coiled coil, fibrinogen-binding | 91.15 | |
| 2no2_A | 107 | HIP-I, huntingtin-interacting protein 1; clathrin | 91.15 | |
| 1m1j_C | 409 | Fibrinogen gamma chain; coiled coils, disulfide ri | 91.13 | |
| 2xnx_M | 146 | M protein, M1-BC1; cell adhesion, virulence factor | 90.85 | |
| 2zqm_A | 117 | Prefoldin beta subunit 1; chaperone; HET: CIT; 1.9 | 90.84 | |
| 1m1j_B | 464 | Fibrinogen beta chain; coiled coils, disulfide rin | 90.82 | |
| 3mq9_A | 471 | Bone marrow stromal antigen 2 fused to maltose-BI | 90.28 | |
| 1fxk_A | 107 | Prefoldin; archaeal protein, chaperone; 2.30A {Met | 90.26 | |
| 1fxk_C | 133 | Protein (prefoldin); archaeal protein, chaperone; | 89.72 | |
| 2i1j_A | 575 | Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, | 89.13 | |
| 3swk_A | 86 | Vimentin; cytoskeleton, intermediate filament, alp | 89.04 | |
| 3i00_A | 120 | HIP-I, huntingtin-interacting protein 1; transcrip | 88.97 | |
| 1m1j_A | 491 | Fibrinogen alpha subunit; coiled coils, disulfide | 88.66 | |
| 1d7m_A | 101 | Cortexillin I; coiled-coil, coiled-coil trigger si | 88.65 | |
| 3iox_A | 497 | AGI/II, PA; alpha helix, PPII helix, supersandwich | 88.48 | |
| 3a7o_A | 75 | Autophagy protein 16; coiled-coil, coiled coil, cy | 88.11 | |
| 2pms_C | 125 | Pneumococcal surface protein A (PSPA); lactoferrin | 87.38 | |
| 2pms_C | 125 | Pneumococcal surface protein A (PSPA); lactoferrin | 87.14 | |
| 2i1j_A | 575 | Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, | 87.12 | |
| 3iv1_A | 78 | Tumor susceptibility gene 101 protein; coiled_COIL | 86.89 | |
| 1x8y_A | 86 | Lamin A/C; structural protein, intermediate filame | 86.64 | |
| 1m1j_A | 491 | Fibrinogen alpha subunit; coiled coils, disulfide | 86.63 | |
| 3cvf_A | 79 | Homer-3, homer protein homolog 3; coiled coil, alt | 85.77 | |
| 2lw1_A | 89 | ABC transporter ATP-binding protein UUP; ABC REG s | 85.66 | |
| 1gk4_A | 84 | Vimentin; intermediate filament, dimer, parallel c | 85.21 | |
| 3l4q_C | 170 | Phosphatidylinositol 3-kinase regulatory subunit b | 84.41 | |
| 1x79_B | 112 | RAB GTPase binding effector protein 1; rabaptin5, | 84.32 | |
| 3iox_A | 497 | AGI/II, PA; alpha helix, PPII helix, supersandwich | 84.28 | |
| 3ghg_C | 411 | Fibrinogen gamma chain; triple-stranded coiled coi | 84.25 | |
| 1m1j_C | 409 | Fibrinogen gamma chain; coiled coils, disulfide ri | 84.01 | |
| 3iv1_A | 78 | Tumor susceptibility gene 101 protein; coiled_COIL | 83.94 | |
| 2nrj_A | 346 | HBL B protein; enterotoxin, hemolysis, transmembra | 83.48 | |
| 2yko_A | 233 | LINE-1 ORF1P; RNA-binding protein, genome evolutio | 83.28 | |
| 2lw1_A | 89 | ABC transporter ATP-binding protein UUP; ABC REG s | 82.78 | |
| 1d7m_A | 101 | Cortexillin I; coiled-coil, coiled-coil trigger si | 82.59 | |
| 3i00_A | 120 | HIP-I, huntingtin-interacting protein 1; transcrip | 82.45 | |
| 3a7o_A | 75 | Autophagy protein 16; coiled-coil, coiled coil, cy | 82.41 | |
| 3htk_A | 60 | Structural maintenance of chromosomes protein 5; S | 82.02 | |
| 3jsv_C | 94 | NF-kappa-B essential modulator; ubiquitin, coiled- | 81.91 | |
| 3hhm_B | 373 | NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil | 81.73 | |
| 2qyw_A | 102 | Vesicle transport through interaction with T-SNAR | 81.41 | |
| 1jcd_A | 52 | Major outer membrane lipoprotein; protein folding, | 81.24 | |
| 3trt_A | 77 | Vimentin; cytoskeleton, intermediate filament, alp | 81.11 | |
| 1cii_A | 602 | Colicin IA; bacteriocin, ION channel formation, tr | 81.09 | |
| 4ad8_A | 517 | DNA repair protein RECN; DNA binding protein, ATPa | 80.93 | |
| 1lwu_C | 323 | Fibrinogen gamma chain; heterotrimer, protein-pept | 80.92 | |
| 3c9i_A | 242 | Tail needle protein GP26; xenon, coiled-coil, prot | 80.78 | |
| 2ke4_A | 98 | CDC42-interacting protein 4; CIP4, TC10, coiled-co | 80.39 |
| >2a01_A Apolipoprotein A-I; four-helix bundle, lipid transport; HET: AC9; 2.40A {Homo sapiens} PDB: 3k2s_A* 1av1_A 3j00_0* | Back alignment and structure |
|---|
Probab=99.16 E-value=3.2e-11 Score=116.56 Aligned_cols=117 Identities=17% Similarity=0.228 Sum_probs=107.0
Q ss_pred cchHHHHHHHHHHHHHccccccchHHHHHhhhhhhHHhHHHhhhcccchhHHHHhhHHHHHHHHhhhhcchhHHhhhhhc
Q 013360 235 PAMDVAIQKALEKKAQAGKWVQPHVETIKAKWIPAVKEQWVVFTTNVEPHVQTLKTKTIEACEATKTAVTPHIIRVQEVV 314 (444)
Q Consensus 235 p~~~~~~~k~~~~~~~~~~w~~p~~~~~~~k~~p~~~~~w~~~~~~~~p~ve~~k~k~~p~~~~~r~~~~p~~~~~~~~~ 314 (444)
|+++++..+....++. ++.++.|++.+ ++.++..||+++++++.|+.+.+|+.+..|++.+++.+
T Consensus 121 P~~eel~~~~~~~~ee-----------l~~~L~p~~ee----lr~kl~~~veelk~~l~P~~ee~r~kl~~~~~el~~~l 185 (243)
T 2a01_A 121 PLRAELQEGARQKLHE-----------LQEKLSPLGEE----MRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENG 185 (243)
T ss_dssp HHHHHHHHHHHHHHHH-----------HCCSCCSSTHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHhhHHH-----------HHHHHHhHHHH----HHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHhc
Confidence 5566777777776666 88899999888 89999999999999999999999999999999999999
Q ss_pred chhHHHHhhhhhhHHHHHHhhcCcchHhHHHhhcccHHHHHHHHHHHHHHHH
Q 013360 315 DPYFQEAKKFSKPYIDQVATVAKPHVDNVRVALKPYTKKVVRAYGKFLKSAT 366 (444)
Q Consensus 315 ~Py~~e~k~~~~py~~~a~~~~~p~~~~~~~~~~Py~~~~~~~~~~~~~~a~ 366 (444)
.||++++++.+.|++++++....||.+.++..+.||++.++..+..+++..+
T Consensus 186 ~p~~~e~~~kl~~~~e~lr~~l~p~~e~lk~~l~p~~e~~~~~l~~~~e~~~ 237 (243)
T 2a01_A 186 GARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYT 237 (243)
T ss_dssp HHTTTSSSCCHHHHHHHHHHHHHHHHHHSSSCSHHHHHHHHHHHHHHHHHHH
T ss_pred chhHHHHHHHHHHHHHHHHHHhHHHHHHHHHHhHHHHHHHHHHHHHHHHHHH
Confidence 9999999999999999999999999999999999999999999998886654
|
| >3s84_A Apolipoprotein A-IV; four helix bundle, transport protein; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3s84_A Apolipoprotein A-IV; four helix bundle, transport protein; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2a01_A Apolipoprotein A-I; four-helix bundle, lipid transport; HET: AC9; 2.40A {Homo sapiens} PDB: 3k2s_A* 1av1_A 3j00_0* | Back alignment and structure |
|---|
| >1nfn_A Apolipoprotein E3; lipid transport, heparin-binding, plasma protein, HDL, VLDL; 1.80A {Homo sapiens} SCOP: a.24.1.1 PDB: 1h7i_A 1ea8_A 1b68_A 1nfo_A 2kc3_A 1ya9_A | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2lem_A Apolipoprotein A-I; lipid transport; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
| >1nfn_A Apolipoprotein E3; lipid transport, heparin-binding, plasma protein, HDL, VLDL; 1.80A {Homo sapiens} SCOP: a.24.1.1 PDB: 1h7i_A 1ea8_A 1b68_A 1nfo_A 2kc3_A 1ya9_A | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
| >2lem_A Apolipoprotein A-I; lipid transport; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3r2p_A Apolipoprotein A-I; amphipathic alpha-helix, major protein of high density lipop (HDL), lipid binding, plasma, lipid transport; 2.20A {Homo sapiens} PDB: 1gw3_A 1gw4_A | Back alignment and structure |
|---|
| >3r2p_A Apolipoprotein A-I; amphipathic alpha-helix, major protein of high density lipop (HDL), lipid binding, plasma, lipid transport; 2.20A {Homo sapiens} PDB: 1gw3_A 1gw4_A | Back alignment and structure |
|---|
| >1gs9_A Apolipoprotein E, APOE4; lipid transport, heparin-binding, plasma, lipid binding protein; 1.7A {Homo sapiens} SCOP: a.24.1.1 PDB: 1or3_A 1or2_A 1le4_A 1bz4_A 1lpe_A 1le2_A | Back alignment and structure |
|---|
| >2l7b_A Apolipoprotein E, APO-E; lipid transport, atherosclerosis, alzheime disease; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l7b_A Apolipoprotein E, APO-E; lipid transport, atherosclerosis, alzheime disease; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >1gs9_A Apolipoprotein E, APOE4; lipid transport, heparin-binding, plasma, lipid binding protein; 1.7A {Homo sapiens} SCOP: a.24.1.1 PDB: 1or3_A 1or2_A 1le4_A 1bz4_A 1lpe_A 1le2_A | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >4gkw_A Spindle assembly abnormal protein 6; double helix, SAS-5, centriole, structural protein; 3.30A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* | Back alignment and structure |
|---|
| >2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} | Back alignment and structure |
|---|
| >1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1 | Back alignment and structure |
|---|
| >2xzr_A Immunoglobulin-binding protein EIBD; cell adhesion, trimeric autotransporter adhesin, TAA; 2.80A {Enterobacteria phage p-eibd} | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3nmd_A CGMP dependent protein kinase; leucine zipper, coiled-coil, structural genomics, berkeley S genomics center, BSGC, dimerization; HET: MSE; 2.27A {Homo sapiens} | Back alignment and structure |
|---|
| >2oto_A M protein; helical coiled coil, fibrinogen-binding, virulence factor, S active protein, toxin; 3.04A {Streptococcus pyogenes serotype M1} PDB: 2xny_M | Back alignment and structure |
|---|
| >2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B* | Back alignment and structure |
|---|
| >2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1 | Back alignment and structure |
|---|
| >3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2zqm_A Prefoldin beta subunit 1; chaperone; HET: CIT; 1.90A {Thermococcus SP} PDB: 2zdi_A | Back alignment and structure |
|---|
| >3qh9_A Liprin-beta-2; coiled-coil, dimerization, structural protein; 2.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3nmd_A CGMP dependent protein kinase; leucine zipper, coiled-coil, structural genomics, berkeley S genomics center, BSGC, dimerization; HET: MSE; 2.27A {Homo sapiens} | Back alignment and structure |
|---|
| >2w83_C C-JUN-amino-terminal kinase-interacting protein 4; golgi apparatus, protein transport, ER-golgi transport, ARF, GTPase, effector, myristate; HET: GTP; 1.93A {Homo sapiens} | Back alignment and structure |
|---|
| >3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3efg_A Protein SLYX homolog; xanthomonas campestris PV. campestris, coiled-coil, structur genomics, PSI-2, protein structure initiative; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3jsv_C NF-kappa-B essential modulator; ubiquitin, coiled-coil, cellular signaling, cytoplasm, isopeptide bond, nucleus, phosphoprotein, UBL conjugation; 2.70A {Mus musculus} PDB: 3f89_A 2zvo_B 2zvn_B | Back alignment and structure |
|---|
| >2oto_A M protein; helical coiled coil, fibrinogen-binding, virulence factor, S active protein, toxin; 3.04A {Streptococcus pyogenes serotype M1} PDB: 2xny_M | Back alignment and structure |
|---|
| >2no2_A HIP-I, huntingtin-interacting protein 1; clathrin light chain binding, HIP1 coiled-coil domain, endocytosis, clathrin SELF-assembly, cell adhesion; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1m1j_C Fibrinogen gamma chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_C | Back alignment and structure |
|---|
| >2xnx_M M protein, M1-BC1; cell adhesion, virulence factor, streptococcal toxic shock S; 3.30A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >2zqm_A Prefoldin beta subunit 1; chaperone; HET: CIT; 1.90A {Thermococcus SP} PDB: 2zdi_A | Back alignment and structure |
|---|
| >1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B* | Back alignment and structure |
|---|
| >3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >1fxk_A Prefoldin; archaeal protein, chaperone; 2.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: a.2.5.1 PDB: 1fxk_B | Back alignment and structure |
|---|
| >1fxk_C Protein (prefoldin); archaeal protein, chaperone; 2.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: a.2.5.1 | Back alignment and structure |
|---|
| >2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A | Back alignment and structure |
|---|
| >3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A | Back alignment and structure |
|---|
| >1m1j_A Fibrinogen alpha subunit; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: h.1.8.1 PDB: 1ei3_A | Back alignment and structure |
|---|
| >1d7m_A Cortexillin I; coiled-coil, coiled-coil trigger site, alpha helix, dimeriza contractIle protein; 2.70A {Dictyostelium discoideum} SCOP: h.1.10.1 | Back alignment and structure |
|---|
| >3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A | Back alignment and structure |
|---|
| >3a7o_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2pms_C Pneumococcal surface protein A (PSPA); lactoferrin, protein-protein metal transport, hydrolase; HET: NAG; 2.91A {Streptococcus pneumoniae} SCOP: h.4.19.1 | Back alignment and structure |
|---|
| >2pms_C Pneumococcal surface protein A (PSPA); lactoferrin, protein-protein metal transport, hydrolase; HET: NAG; 2.91A {Streptococcus pneumoniae} SCOP: h.4.19.1 | Back alignment and structure |
|---|
| >2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A | Back alignment and structure |
|---|
| >3iv1_A Tumor susceptibility gene 101 protein; coiled_COIL, tumorigenesis, CELL_cycle regulation, alternative splicing, cell cycle, cell division; HET: MSE; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1x8y_A Lamin A/C; structural protein, intermediate filament protein; 2.20A {Homo sapiens} SCOP: h.1.20.1 PDB: 3v5b_A 3v4w_A 3v4q_A | Back alignment and structure |
|---|
| >1m1j_A Fibrinogen alpha subunit; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: h.1.8.1 PDB: 1ei3_A | Back alignment and structure |
|---|
| >3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2lw1_A ABC transporter ATP-binding protein UUP; ABC REG subfamily, DNA binding protein; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >1gk4_A Vimentin; intermediate filament, dimer, parallel coiled coil, heptad repeat, stutter; 2.3A {Homo sapiens} SCOP: h.1.20.1 | Back alignment and structure |
|---|
| >3l4q_C Phosphatidylinositol 3-kinase regulatory subunit beta; PI3K, phosphoinositide-3-kinase, influenza virus, NS1; 2.30A {Bos taurus} PDB: 2v1y_B | Back alignment and structure |
|---|
| >1x79_B RAB GTPase binding effector protein 1; rabaptin5, GGA protein, GAT domain, intracellular trafficking, protein transport; 2.41A {Homo sapiens} SCOP: h.1.27.2 | Back alignment and structure |
|---|
| >3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A | Back alignment and structure |
|---|
| >3ghg_C Fibrinogen gamma chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 1deq_C | Back alignment and structure |
|---|
| >1m1j_C Fibrinogen gamma chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_C | Back alignment and structure |
|---|
| >3iv1_A Tumor susceptibility gene 101 protein; coiled_COIL, tumorigenesis, CELL_cycle regulation, alternative splicing, cell cycle, cell division; HET: MSE; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2nrj_A HBL B protein; enterotoxin, hemolysis, transmembrane, structural genomics, PSI-2, protein structure initiative; 2.03A {Bacillus cereus} SCOP: h.4.4.2 | Back alignment and structure |
|---|
| >2yko_A LINE-1 ORF1P; RNA-binding protein, genome evolution, nucleic acid chaperon coiled-coil; HET: MSE; 2.10A {Homo sapiens} PDB: 2ykp_A 2ykq_A 2ldy_A | Back alignment and structure |
|---|
| >2lw1_A ABC transporter ATP-binding protein UUP; ABC REG subfamily, DNA binding protein; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >1d7m_A Cortexillin I; coiled-coil, coiled-coil trigger site, alpha helix, dimeriza contractIle protein; 2.70A {Dictyostelium discoideum} SCOP: h.1.10.1 | Back alignment and structure |
|---|
| >3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A | Back alignment and structure |
|---|
| >3a7o_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3htk_A Structural maintenance of chromosomes protein 5; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3jsv_C NF-kappa-B essential modulator; ubiquitin, coiled-coil, cellular signaling, cytoplasm, isopeptide bond, nucleus, phosphoprotein, UBL conjugation; 2.70A {Mus musculus} PDB: 3f89_A 2zvo_B 2zvn_B | Back alignment and structure |
|---|
| >3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A | Back alignment and structure |
|---|
| >2qyw_A Vesicle transport through interaction with T-SNAR homolog; HABC domain, protein transport, endocytosis; 2.00A {Mus musculus} PDB: 2v8s_V | Back alignment and structure |
|---|
| >1jcd_A Major outer membrane lipoprotein; protein folding, coiled coil, helix capping, alanine-zipper, membrane protein; 1.30A {Escherichia coli} SCOP: h.1.16.1 PDB: 1eq7_A 1t8z_A* 2guv_A 2gus_A 1jcc_A 1kfn_A 1kfm_A | Back alignment and structure |
|---|
| >3trt_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural protein; 2.30A {Homo sapiens} PDB: 3klt_A* | Back alignment and structure |
|---|
| >1cii_A Colicin IA; bacteriocin, ION channel formation, transmembrane protein; 3.00A {Escherichia coli} SCOP: f.1.1.1 h.4.3.1 | Back alignment and structure |
|---|
| >4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1lwu_C Fibrinogen gamma chain; heterotrimer, protein-peptide complex, blood clotting; HET: NDG MAN NAG BMA GAL; 2.80A {Petromyzon marinus} SCOP: d.171.1.1 h.1.8.1 PDB: 1n73_C* | Back alignment and structure |
|---|
| >3c9i_A Tail needle protein GP26; xenon, coiled-coil, protein fiber, coiled coil, late protein, viral protein; 1.95A {Bacteriophage P22} PDB: 2poh_A | Back alignment and structure |
|---|
| >2ke4_A CDC42-interacting protein 4; CIP4, TC10, coiled-coil, alternative splicing, cell membrane, coiled coil, cytoplasm, cytoskeleton, endocytosis; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 444 | ||||
| d1gs9a_ | 144 | a.24.1.1 (A:) Apolipoprotein E {Human (Homo sapien | 0.001 |
| >d1gs9a_ a.24.1.1 (A:) Apolipoprotein E {Human (Homo sapiens), E4 [TaxId: 9606]} Length = 144 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Four-helical up-and-down bundle superfamily: Apolipoprotein family: Apolipoprotein domain: Apolipoprotein E species: Human (Homo sapiens), E4 [TaxId: 9606]
Score = 37.1 bits (86), Expect = 0.001
Identities = 10/98 (10%), Positives = 35/98 (35%), Gaps = 4/98 (4%)
Query: 255 VQPHVETIKAKWIPAVKEQWVVFTTNVEPHVQTLKTKTIEACEATKTAVTPHIIRVQEVV 314
++ + ++ + P +E + +Q + + E + + + VQ ++
Sbjct: 50 LKAYKSELEEQLTPVAEE----TRARLSKELQAAQARLGADMEDVRGRLVQYRGEVQAML 105
Query: 315 DPYFQEAKKFSKPYIDQVATVAKPHVDNVRVALKPYTK 352
+E + ++ ++ D+++ L Y
Sbjct: 106 GQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQA 143
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 444 | |||
| d1gs9a_ | 144 | Apolipoprotein E {Human (Homo sapiens), E4 [TaxId: | 98.53 | |
| d1gs9a_ | 144 | Apolipoprotein E {Human (Homo sapiens), E4 [TaxId: | 98.4 | |
| d2ap3a1 | 185 | Hypothetical protein MW0975 (SA0943) {Staphylococc | 95.05 | |
| d1fxkc_ | 133 | Prefoldin alpha subunit {Archaeon Methanobacterium | 93.31 | |
| d2ap3a1 | 185 | Hypothetical protein MW0975 (SA0943) {Staphylococc | 92.59 | |
| d1seta1 | 110 | Seryl-tRNA synthetase (SerRS) {Thermus thermophilu | 91.86 | |
| d1fxka_ | 107 | Prefoldin beta subunit {Archaeon Methanobacterium | 91.82 | |
| d1fxka_ | 107 | Prefoldin beta subunit {Archaeon Methanobacterium | 91.05 | |
| d1fxkc_ | 133 | Prefoldin alpha subunit {Archaeon Methanobacterium | 89.31 | |
| d1seta1 | 110 | Seryl-tRNA synthetase (SerRS) {Thermus thermophilu | 85.08 |
| >d1gs9a_ a.24.1.1 (A:) Apolipoprotein E {Human (Homo sapiens), E4 [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Four-helical up-and-down bundle superfamily: Apolipoprotein family: Apolipoprotein domain: Apolipoprotein E species: Human (Homo sapiens), E4 [TaxId: 9606]
Probab=98.53 E-value=2.8e-08 Score=86.26 Aligned_cols=89 Identities=11% Similarity=0.123 Sum_probs=46.8
Q ss_pred hHHHHHhhhhhhHHhHHHhhhcccchhHHHHhhHHHHHHHHhhhhcchhHHhhhhhcchhHHHHhhhhhhHHHHHHhhcC
Q 013360 258 HVETIKAKWIPAVKEQWVVFTTNVEPHVQTLKTKTIEACEATKTAVTPHIIRVQEVVDPYFQEAKKFSKPYIDQVATVAK 337 (444)
Q Consensus 258 ~~~~~~~k~~p~~~~~w~~~~~~~~p~ve~~k~k~~p~~~~~r~~~~p~~~~~~~~~~Py~~e~k~~~~py~~~a~~~~~ 337 (444)
+++.++.++.|++.+ ++..+.++++.++..+.|..+.+|+.+.||+..+++.+.|++++++..+.||.+..++-..
T Consensus 53 ~~~~l~~~l~p~~~e----~~~~l~~~~e~lr~~l~~~lee~r~kl~~~~eel~~~~~~~~ee~r~~l~p~~eel~~~l~ 128 (144)
T d1gs9a_ 53 YKSELEEQLTPVAEE----TRARLSKELQAAQARLGADMEDVRGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLL 128 (144)
T ss_dssp HHHHHTTSCCCCCSH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTSTTCCCHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHH----HHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 344455555555544 4444445555555555555555555555555555555555555555555555555555555
Q ss_pred cchHhHHHhhccc
Q 013360 338 PHVDNVRVALKPY 350 (444)
Q Consensus 338 p~~~~~~~~~~Py 350 (444)
++++.++..+.||
T Consensus 129 ~~~eel~~kL~py 141 (144)
T d1gs9a_ 129 RDADDLQKRLAVY 141 (144)
T ss_dssp HHHHHHHHHHHHS
T ss_pred HHHHHHHHHhhCc
Confidence 5555555555555
|
| >d1gs9a_ a.24.1.1 (A:) Apolipoprotein E {Human (Homo sapiens), E4 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ap3a1 a.24.27.1 (A:12-196) Hypothetical protein MW0975 (SA0943) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1fxkc_ a.2.5.1 (C:) Prefoldin alpha subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2ap3a1 a.24.27.1 (A:12-196) Hypothetical protein MW0975 (SA0943) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1seta1 a.2.7.1 (A:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1fxka_ a.2.5.1 (A:) Prefoldin beta subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1fxka_ a.2.5.1 (A:) Prefoldin beta subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1fxkc_ a.2.5.1 (C:) Prefoldin alpha subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1seta1 a.2.7.1 (A:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} | Back information, alignment and structure |
|---|