BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 013393
         (444 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1UMZ|A Chain A, Xyloglucan Endotransglycosylase In Complex With The
          Xyloglucan Nonasaccharide Xllg.
 pdb|1UMZ|B Chain B, Xyloglucan Endotransglycosylase In Complex With The
          Xyloglucan Nonasaccharide Xllg.
 pdb|1UN1|A Chain A, Xyloglucan Endotransglycosylase Native Structure.
 pdb|1UN1|B Chain B, Xyloglucan Endotransglycosylase Native Structure
          Length = 278

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 25/56 (44%), Gaps = 3/56 (5%)

Query: 34 FPSDKLNNGGN-IRNVLD--VGCGVASFGAYLLSHDIIAMSLAPNDVHENQIQFAL 86
          F   K  NGGN I+  LD   G G  S G+YL  H  + M L P D       F L
Sbjct: 27 FDHIKYFNGGNEIQLHLDKYTGTGFQSKGSYLFGHFSMQMKLVPGDSAGTVTAFYL 82


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.321    0.137    0.438 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 14,369,219
Number of Sequences: 62578
Number of extensions: 612881
Number of successful extensions: 1486
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1486
Number of HSP's gapped (non-prelim): 1
length of query: 444
length of database: 14,973,337
effective HSP length: 102
effective length of query: 342
effective length of database: 8,590,381
effective search space: 2937910302
effective search space used: 2937910302
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 53 (25.0 bits)