Citrus Sinensis ID: 013409


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440---
MKGFREKAGASKCFSKSTPDTPNRSLASVGSELGSSETVKRLVTAGSMRRIHERVLGPSRTGISSSTSDIWLLGVCHKIAQDEALGDAAGNNGLAEFNQDFSSRILISYRKGFDPIGDSKITSDVGWGCMLRSSQMLVAQALLFHRLGRPWRKPLQKPFDREYVEILHLFGDSETSPFSIHNLLQAGKAYGLAAGSWVGPYAMCRSWEALARCQRAETGLGCQSLPMAIYVVSGDEDGERGGAPVVCIDDASRHCSVFSKGQADWTPILLLVPLVLGLEKVNPRYIPTLRLTFTFPQSLGIVGGKPGASTYIVGVQEESAIYLDPHDVQPVINIGKDDLEADTSTYHSDVIRHIHLDSIDPSLAIGFYCRDKDDFDDFCARASKLAEESNGAPLFTVTQTHKKPVNHSDVLGETGGVPEDDSLGVMSMNDAVGNAHEDDWQLL
ccccEECccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccEEEcccEEccccccccccccccccHHHHHHHccEEEEEEEcccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccHHHHHHHHHccccccccccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHccccccccccccEEEEECcccccccccccEECccccccccccccccccccccEEEEEEcccccccccccHHHHHHHHHccccccEEEccccccEEEEEEEEcccEEEEccccccccccccccccccccccccccccccccccccccccEEEEEEccHHHHHHHHHHHHHHHHcccccccEEEEccccccccccccccccccccccccccccccccccccccccccccc
*******************************************TAGSMRRIHERVLGPSR***SSSTSDIWLLGVCHKIAQD*******GNNGLAEFNQDFSSRILISYRKGFDPIGDSKITSDVGWGCMLRSSQMLVAQALLFHRLGRPWRKPLQKPFDREYVEILHLFGDSETSPFSIHNLLQAGKAYGLAAGSWVGPYAMCRSWEALARCQRAETGLGCQSLPMAIYVVSGDEDGERGGAPVVCIDDASRHCSVFSKGQADWTPILLLVPLVLGLEKVNPRYIPTLRLTFTFPQSLGIVGGKPGASTYIVGVQEESAIYLDPHDVQPVINIGKDDLEADTSTYHSDVIRHIHLDSIDPSLAIGFYCRDKDDFDDFCARASK****SNGAPLFTVTQT*********************************NAH*DDWQLL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKGFREKAGASKCFSKSTPDTPNRSLASVGSELGSSETVKRLVTAGSMRRIHERVLGPSRTGISSSTSDIWLLGVCHKIAQDEALGDAAGNNGLAEFNQDFSSRILISYRKGFDPIGDSKITSDVGWGCMLRSSQMLVAQALLFHRLGRPWRKPLQKPFDREYVEILHLFGDSETSPFSIHNLLQAGKAYGLAAGSWVGPYAMCRSWEALARCQRAETGLGCQSLPMAIYVVSGDEDGERGGAPVVCIDDASRHCSVFSKGQADWTPILLLVPLVLGLEKVNPRYIPTLRLTFTFPQSLGIVGGKPGASTYIVGVQEESAIYLDPHDVQPVINIGKDDLEADTSTYHSDVIRHIHLDSIDPSLAIGFYCRDKDDFDDFCARASKLAEESNGAPLFTVTQTHKKPVNHSDVLGETGGVPEDDSLGVMSMNDAVGNAHEDDWQLL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cysteine protease ATG4a Cysteine protease required for autophagy, which is able to cleave the C-terminal part of ATG8 that may be subsequently converted to a smaller form, with a revealed C-terminal glycine. ATG8 is then activated by ATG7 and is subsequently attached to ATG3, another E2-like enzyme, after which the C-terminal glycine of ATG8 is conjugated to phosphatidylethanolamine by an amide bond. This conjugated form has the capacity for the binding to autophagosomes.probableQ8S929
Cysteine protease ATG4B Cysteine protease required for autophagy, which is able to cleave the C-terminal part of ATG8 that may be subsequently converted to a smaller form, with a revealed C-terminal glycine. The C-terminal glycine of ATG8 is conjugated to phosphatidylethanolamine by an amide bond. This conjugated form has the capacity for the binding to autophagosomes.probableQ7XPW8
Cysteine protease ATG4A Cysteine protease required for autophagy, which is able to cleave the C-terminal part of ATG8 that may be subsequently converted to a smaller form, with a revealed C-terminal glycine. The C-terminal glycine of ATG8 is conjugated to phosphatidylethanolamine by an amide bond. This conjugated form has the capacity for the binding to autophagosomes.probableA2XHJ5

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CY7, chain A
Confidence level:very confident
Coverage over the Query: 59-82,94-416
View the alignment between query and template
View the model in PyMOL