BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 013416
         (443 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1SU5|A Chain A, Understanding Protein Lids: Structural Analysis Of Active
           Hinge Mutants In Triosephosphate Isomerase
 pdb|1SU5|B Chain B, Understanding Protein Lids: Structural Analysis Of Active
           Hinge Mutants In Triosephosphate Isomerase
          Length = 247

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 12/42 (28%), Positives = 20/42 (47%)

Query: 28  TGNKNNNNTTHRSWQNVKSWIKPHSERSTSMSTTALFGGKNT 69
           TGN N         + ++ W+K H   + + ST  ++GG  T
Sbjct: 171 TGNPNTPQQAQEVHEKLRGWLKSHVSDAVAQSTRIIYGGSVT 212


>pdb|1SW7|A Chain A, Triosephosphate Isomerase From Gallus Gallus, Loop 6
           Mutant K174n, T175s, A176s
 pdb|1SW7|B Chain B, Triosephosphate Isomerase From Gallus Gallus, Loop 6
           Mutant K174n, T175s, A176s
          Length = 248

 Score = 28.5 bits (62), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 11/42 (26%), Positives = 20/42 (47%)

Query: 28  TGNKNNNNTTHRSWQNVKSWIKPHSERSTSMSTTALFGGKNT 69
           TGN +         + ++ W+K H   + + ST  ++GG  T
Sbjct: 172 TGNSSTPQQAQEVHEKLRGWLKSHVSDAVAQSTRIIYGGSVT 213


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.317    0.132    0.397 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 12,479,599
Number of Sequences: 62578
Number of extensions: 473095
Number of successful extensions: 989
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 986
Number of HSP's gapped (non-prelim): 8
length of query: 443
length of database: 14,973,337
effective HSP length: 102
effective length of query: 341
effective length of database: 8,590,381
effective search space: 2929319921
effective search space used: 2929319921
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)