BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 013424
(443 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2R6A|A Chain A, Crystal Form Bh1
pdb|2R6A|B Chain B, Crystal Form Bh1
pdb|2R6E|A Chain A, Crystal Form B2
pdb|2R6E|B Chain B, Crystal Form B2
pdb|2R6C|A Chain A, Crystal Form Bh2
pdb|2R6C|B Chain B, Crystal Form Bh2
pdb|2R6C|C Chain C, Crystal Form Bh2
pdb|2R6C|D Chain D, Crystal Form Bh2
pdb|2R6C|E Chain E, Crystal Form Bh2
pdb|2R6C|F Chain F, Crystal Form Bh2
pdb|2R6D|A Chain A, Crystal Form B1
pdb|2R6D|B Chain B, Crystal Form B1
pdb|2R6D|C Chain C, Crystal Form B1
pdb|2R6D|D Chain D, Crystal Form B1
pdb|2R6D|E Chain E, Crystal Form B1
pdb|2R6D|F Chain F, Crystal Form B1
pdb|4ESV|A Chain A, A New Twist On The Translocation Mechanism Of Helicases
From The Structure Of Dnab With Its Substrates
pdb|4ESV|B Chain B, A New Twist On The Translocation Mechanism Of Helicases
From The Structure Of Dnab With Its Substrates
pdb|4ESV|C Chain C, A New Twist On The Translocation Mechanism Of Helicases
From The Structure Of Dnab With Its Substrates
pdb|4ESV|D Chain D, A New Twist On The Translocation Mechanism Of Helicases
From The Structure Of Dnab With Its Substrates
pdb|4ESV|E Chain E, A New Twist On The Translocation Mechanism Of Helicases
From The Structure Of Dnab With Its Substrates
pdb|4ESV|F Chain F, A New Twist On The Translocation Mechanism Of Helicases
From The Structure Of Dnab With Its Substrates
pdb|4ESV|G Chain G, A New Twist On The Translocation Mechanism Of Helicases
From The Structure Of Dnab With Its Substrates
pdb|4ESV|H Chain H, A New Twist On The Translocation Mechanism Of Helicases
From The Structure Of Dnab With Its Substrates
pdb|4ESV|I Chain I, A New Twist On The Translocation Mechanism Of Helicases
From The Structure Of Dnab With Its Substrates
pdb|4ESV|J Chain J, A New Twist On The Translocation Mechanism Of Helicases
From The Structure Of Dnab With Its Substrates
pdb|4ESV|K Chain K, A New Twist On The Translocation Mechanism Of Helicases
From The Structure Of Dnab With Its Substrates
pdb|4ESV|L Chain L, A New Twist On The Translocation Mechanism Of Helicases
From The Structure Of Dnab With Its Substrates
Length = 454
Score = 29.3 bits (64), Expect = 4.4, Method: Compositional matrix adjust.
Identities = 26/105 (24%), Positives = 46/105 (43%), Gaps = 13/105 (12%)
Query: 14 ISPSKLRMKLIGPHHNRKKDGSNSNSARTSPSRLDDSEFVRNSLLNGG-FDDEAPSLEVA 72
+S +L M+++ N + N + + +P SL N G + D+ PS+ V+
Sbjct: 242 MSAQQLVMRMLCAEGN--INAQNLRTGKLTPEDWGKLTMAMGSLSNAGIYIDDTPSIRVS 299
Query: 73 S----------EKGAGEVVLGHNQGEQASFQPNETLPRENTEVSR 107
E G G +V+ + Q Q S + E +E +E+SR
Sbjct: 300 DIRAKCRRLKQESGLGMIVIDYLQLIQGSGRSKENRQQEVSEISR 344
>pdb|2VYE|A Chain A, Crystal Structure Of The Dnac-Ssdna Complex
pdb|2VYE|B Chain B, Crystal Structure Of The Dnac-Ssdna Complex
pdb|2VYF|A Chain A, Crystal Structure Of The Dnac
pdb|2VYF|B Chain B, Crystal Structure Of The Dnac
Length = 454
Score = 29.3 bits (64), Expect = 5.0, Method: Compositional matrix adjust.
Identities = 27/105 (25%), Positives = 46/105 (43%), Gaps = 13/105 (12%)
Query: 14 ISPSKLRMKLIGPHHNRKKDGSNSNSARTSPSRLDDSEFVRNSLLNGG-FDDEAPSLEVA 72
+S +L M+++ N + N + + +P SL N G + D+ PS+ V+
Sbjct: 242 MSAQQLVMRMLCAEGN--INAQNLRTGKLTPEDWGKLTMAMGSLSNAGIYIDDTPSIRVS 299
Query: 73 S----------EKGAGEVVLGHNQGEQASFQPNETLPRENTEVSR 107
E G G VV+ + Q Q S + E +E +E+SR
Sbjct: 300 DIRAKCRRLKQESGLGMVVIDYLQLIQGSGRNRENRQQEVSEISR 344
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.310 0.123 0.349
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 12,341,261
Number of Sequences: 62578
Number of extensions: 478122
Number of successful extensions: 753
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 752
Number of HSP's gapped (non-prelim): 3
length of query: 443
length of database: 14,973,337
effective HSP length: 102
effective length of query: 341
effective length of database: 8,590,381
effective search space: 2929319921
effective search space used: 2929319921
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 53 (25.0 bits)