BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 013443
         (443 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3DF7|A Chain A, Crystal Structure Of A Putative Atp-Grasp Superfamily
           Protein From Archaeoglobus Fulgidus
          Length = 305

 Score = 28.9 bits (63), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 20/36 (55%)

Query: 53  FLIVAPMSVFCVFVARKLMDDYPHHLGISIMVVAVT 88
           FLI+AP   F ++   K  + Y  +LG S   +AVT
Sbjct: 73  FLIIAPEDDFLLYTLTKKAEKYCENLGSSSRAIAVT 108


>pdb|1HQM|C Chain C, Crystal Structure Of Thermus Aquaticus Core Rna Polymerase-
            Includes Complete Structure With Side-Chains (Except For
            Disordered Regions)-Further Refined From Original
            Deposition-Contains Additional Sequence Information
          Length = 1119

 Score = 28.5 bits (62), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 338  DDIEMGRKTVWGDVGPGGDLTEGQLPNNDRINVKDGELAELSPDIRTTVEEGDRVGI 394
            DDIE GR   +  +  G D+ E  +P + R+ VK  EL  L+ D++T  E+ + V I
Sbjct: 1058 DDIE-GRNAAYQAIIKGEDVPEPSVPESFRVLVK--ELQALALDVQTLDEKDNPVDI 1111


>pdb|1L9U|C Chain C, Thermus Aquaticus Rna Polymerase Holoenzyme At 4 A
            Resolution
 pdb|1L9U|L Chain L, Thermus Aquaticus Rna Polymerase Holoenzyme At 4 A
            Resolution
 pdb|1L9Z|C Chain C, Thermus Aquaticus Rna Polymerase HoloenzymeFORK-Junction
            Promoter Dna Complex At 6.5 A Resolution
          Length = 1118

 Score = 28.5 bits (62), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 338  DDIEMGRKTVWGDVGPGGDLTEGQLPNNDRINVKDGELAELSPDIRTTVEEGDRVGI 394
            DDIE GR   +  +  G D+ E  +P + R+ VK  EL  L+ D++T  E+ + V I
Sbjct: 1057 DDIE-GRNAAYQAIIKGEDVPEPSVPESFRVLVK--ELQALALDVQTLDEKDNPVDI 1110


>pdb|1YNJ|C Chain C, Taq Rna Polymerase-Sorangicin Complex
 pdb|1YNN|C Chain C, Taq Rna Polymerase-rifampicin Complex
 pdb|2GHO|C Chain C, Recombinant Thermus Aquaticus Rna Polymerase For Structural
            Studies
          Length = 1119

 Score = 28.1 bits (61), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 338  DDIEMGRKTVWGDVGPGGDLTEGQLPNNDRINVKDGELAELSPDIRTTVEEGDRVGI 394
            DDIE GR   +  +  G D+ E  +P + R+ VK  EL  L+ D++T  E+ + V I
Sbjct: 1058 DDIE-GRNAAYQAIIKGEDVPEPSVPESFRVLVK--ELQALALDVQTLDEKDNPVDI 1111


>pdb|1IW7|C Chain C, Crystal Structure Of The Rna Polymerase Holoenzyme From
            Thermus Thermophilus At 2.6a Resolution
 pdb|1IW7|M Chain M, Crystal Structure Of The Rna Polymerase Holoenzyme From
            Thermus Thermophilus At 2.6a Resolution
 pdb|1SMY|C Chain C, Structural Basis For Transcription Regulation By Alarmone
            Ppgpp
 pdb|1SMY|M Chain M, Structural Basis For Transcription Regulation By Alarmone
            Ppgpp
 pdb|1ZYR|C Chain C, Structure Of Thermus Thermophilus Rna Polymerase Holoenzyme
            In Complex With The Antibiotic Streptolydigin
 pdb|1ZYR|M Chain M, Structure Of Thermus Thermophilus Rna Polymerase Holoenzyme
            In Complex With The Antibiotic Streptolydigin
 pdb|2A68|C Chain C, Crystal Structure Of The T. Thermophilus Rna Polymerase
            Holoenzyme In Complex With Antibiotic Rifabutin
 pdb|2A68|M Chain M, Crystal Structure Of The T. Thermophilus Rna Polymerase
            Holoenzyme In Complex With Antibiotic Rifabutin
 pdb|2A69|C Chain C, Crystal Structure Of The T. Thermophilus Rna Polymerase
            Holoenzyme In Complex With Antibiotic Rifapentin
 pdb|2A69|M Chain M, Crystal Structure Of The T. Thermophilus Rna Polymerase
            Holoenzyme In Complex With Antibiotic Rifapentin
 pdb|2A6E|C Chain C, Crystal Structure Of The T. Thermophilus Rna Polymerase
            Holoenzyme
 pdb|2A6E|M Chain M, Crystal Structure Of The T. Thermophilus Rna Polymerase
            Holoenzyme
 pdb|2A6H|C Chain C, Crystal Structure Of The T. Thermophilus Rna Polymerase
            Holoenzyme In Complex With Antibiotic Sterptolydigin
 pdb|2A6H|M Chain M, Crystal Structure Of The T. Thermophilus Rna Polymerase
            Holoenzyme In Complex With Antibiotic Sterptolydigin
 pdb|2CW0|C Chain C, Crystal Structure Of Thermus Thermophilus Rna Polymerase
            Holoenzyme At 3.3 Angstroms Resolution
 pdb|2CW0|M Chain M, Crystal Structure Of Thermus Thermophilus Rna Polymerase
            Holoenzyme At 3.3 Angstroms Resolution
 pdb|2BE5|C Chain C, Crystal Structure Of The T. Thermophilus Rna Polymerase
            Holoenzyme In Complex With Inhibitor Tagetitoxin
 pdb|2BE5|M Chain M, Crystal Structure Of The T. Thermophilus Rna Polymerase
            Holoenzyme In Complex With Inhibitor Tagetitoxin
 pdb|2O5I|C Chain C, Crystal Structure Of The T. Thermophilus Rna Polymerase
            Elongation Complex
 pdb|2O5I|M Chain M, Crystal Structure Of The T. Thermophilus Rna Polymerase
            Elongation Complex
 pdb|2O5J|C Chain C, Crystal Structure Of The T. Thermophilus Rnap Polymerase
            Elongation Complex With The Ntp Substrate Analog
 pdb|2O5J|M Chain M, Crystal Structure Of The T. Thermophilus Rnap Polymerase
            Elongation Complex With The Ntp Substrate Analog
 pdb|2PPB|C Chain C, Crystal Structure Of The T. Thermophilus Rnap Polymerase
            Elongation Complex With The Ntp Substrate Analog And
            Antibiotic Streptolydigin
 pdb|2PPB|M Chain M, Crystal Structure Of The T. Thermophilus Rnap Polymerase
            Elongation Complex With The Ntp Substrate Analog And
            Antibiotic Streptolydigin
 pdb|3DXJ|C Chain C, Crystal Structure Of Thermus Thermophilus Rna Polymerase
            Holoenzyme In Complex With The Antibiotic Myxopyronin
 pdb|3DXJ|M Chain M, Crystal Structure Of Thermus Thermophilus Rna Polymerase
            Holoenzyme In Complex With The Antibiotic Myxopyronin
 pdb|3EQL|C Chain C, Crystal Structure Of The T. Thermophilus Rna Polymerase
            Holoenzyme In Complex With Antibiotic Myxopyronin
 pdb|3EQL|M Chain M, Crystal Structure Of The T. Thermophilus Rna Polymerase
            Holoenzyme In Complex With Antibiotic Myxopyronin
 pdb|3AOH|C Chain C, Rna Polymerase-Gfh1 Complex (Crystal Type 1)
 pdb|3AOH|H Chain H, Rna Polymerase-Gfh1 Complex (Crystal Type 1)
 pdb|3AOH|M Chain M, Rna Polymerase-Gfh1 Complex (Crystal Type 1)
 pdb|3AOI|C Chain C, Rna Polymerase-Gfh1 Complex (Crystal Type 2)
 pdb|3AOI|H Chain H, Rna Polymerase-Gfh1 Complex (Crystal Type 2)
 pdb|3AOI|M Chain M, Rna Polymerase-Gfh1 Complex (Crystal Type 2)
 pdb|4G7H|C Chain C, Crystal Structure Of Thermus Thermophilus Transcription
            Initiation Complex
 pdb|4G7H|M Chain M, Crystal Structure Of Thermus Thermophilus Transcription
            Initiation Complex
 pdb|4G7O|C Chain C, Crystal Structure Of Thermus Thermophilus Transcription
            Initiation Complex Containing 2 Nt Of Rna
 pdb|4G7O|M Chain M, Crystal Structure Of Thermus Thermophilus Transcription
            Initiation Complex Containing 2 Nt Of Rna
 pdb|4G7Z|C Chain C, Crystal Structure Of Thermus Thermophilus Transcription
            Initiation Complex Containing 5-Bru At Template-Strand
            Position +1
 pdb|4G7Z|M Chain M, Crystal Structure Of Thermus Thermophilus Transcription
            Initiation Complex Containing 5-Bru At Template-Strand
            Position +1
 pdb|4GZY|C Chain C, Crystal Structures Of Bacterial Rna Polymerase Paused
            Elongation Complexes
 pdb|4GZZ|C Chain C, Crystal Structures Of Bacterial Rna Polymerase Paused
            Elongation Complexes
          Length = 1119

 Score = 28.1 bits (61), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 338  DDIEMGRKTVWGDVGPGGDLTEGQLPNNDRINVKDGELAELSPDIRTTVEEGDRVGI 394
            DDIE GR   +  +  G D+ E  +P + R+ VK  EL  L+ D++T  E+ + V I
Sbjct: 1058 DDIE-GRNAAYEAIIKGEDVPEPSVPESFRVLVK--ELQALALDVQTLDEKDNPVDI 1111


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.325    0.142    0.455 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 13,327,549
Number of Sequences: 62578
Number of extensions: 565744
Number of successful extensions: 1189
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 6
Number of HSP's that attempted gapping in prelim test: 1188
Number of HSP's gapped (non-prelim): 7
length of query: 443
length of database: 14,973,337
effective HSP length: 102
effective length of query: 341
effective length of database: 8,590,381
effective search space: 2929319921
effective search space used: 2929319921
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 53 (25.0 bits)