BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 013452
         (442 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3A6N|D Chain D, The Nucleosome Containing A Testis-Specific Histone
           Variant, Human H3t
 pdb|3A6N|H Chain H, The Nucleosome Containing A Testis-Specific Histone
           Variant, Human H3t
 pdb|3AFA|D Chain D, The Human Nucleosome Structure
 pdb|3AFA|H Chain H, The Human Nucleosome Structure
 pdb|3AV1|D Chain D, The Human Nucleosome Structure Containing The Histone
           Variant H3.2
 pdb|3AV1|H Chain H, The Human Nucleosome Structure Containing The Histone
           Variant H3.2
 pdb|3AV2|D Chain D, The Human Nucleosome Structure Containing The Histone
           Variant H3.3
 pdb|3AV2|H Chain H, The Human Nucleosome Structure Containing The Histone
           Variant H3.3
 pdb|3AYW|D Chain D, Crystal Structure Of Human Nucleosome Core Particle
           Containing H3k56q Mutation
 pdb|3AYW|H Chain H, Crystal Structure Of Human Nucleosome Core Particle
           Containing H3k56q Mutation
 pdb|3AZE|D Chain D, Crystal Structure Of Human Nucleosome Core Particle
           Containing H3k64q Mutation
 pdb|3AZE|H Chain H, Crystal Structure Of Human Nucleosome Core Particle
           Containing H3k64q Mutation
 pdb|3AZF|D Chain D, Crystal Structure Of Human Nucleosome Core Particle
           Containing H3k79q Mutation
 pdb|3AZF|H Chain H, Crystal Structure Of Human Nucleosome Core Particle
           Containing H3k79q Mutation
 pdb|3AZG|D Chain D, Crystal Structure Of Human Nucleosome Core Particle
           Containing H3k115q Mutation
 pdb|3AZG|H Chain H, Crystal Structure Of Human Nucleosome Core Particle
           Containing H3k115q Mutation
 pdb|3AZH|D Chain D, Crystal Structure Of Human Nucleosome Core Particle
           Containing H3k122q Mutation
 pdb|3AZH|H Chain H, Crystal Structure Of Human Nucleosome Core Particle
           Containing H3k122q Mutation
 pdb|3AZI|D Chain D, Crystal Structure Of Human Nucleosome Core Particle
           Containing H4k31q Mutation
 pdb|3AZI|H Chain H, Crystal Structure Of Human Nucleosome Core Particle
           Containing H4k31q Mutation
 pdb|3AZJ|D Chain D, Crystal Structure Of Human Nucleosome Core Particle
           Containing H4k44q Mutation
 pdb|3AZJ|H Chain H, Crystal Structure Of Human Nucleosome Core Particle
           Containing H4k44q Mutation
 pdb|3AZK|D Chain D, Crystal Structure Of Human Nucleosome Core Particle
           Containing H4k59q Mutation
 pdb|3AZK|H Chain H, Crystal Structure Of Human Nucleosome Core Particle
           Containing H4k59q Mutation
 pdb|3AZL|D Chain D, Crystal Structure Of Human Nucleosome Core Particle
           Containing H4k77q Mutation
 pdb|3AZL|H Chain H, Crystal Structure Of Human Nucleosome Core Particle
           Containing H4k77q Mutation
 pdb|3AZM|D Chain D, Crystal Structure Of Human Nucleosome Core Particle
           Containing H4k79q Mutation
 pdb|3AZM|H Chain H, Crystal Structure Of Human Nucleosome Core Particle
           Containing H4k79q Mutation
 pdb|3AZN|D Chain D, Crystal Structure Of Human Nucleosome Core Particle
           Containing H4k91q Mutation
 pdb|3AZN|H Chain H, Crystal Structure Of Human Nucleosome Core Particle
           Containing H4k91q Mutation
          Length = 129

 Score = 28.1 bits (61), Expect = 8.9,   Method: Composition-based stats.
 Identities = 20/67 (29%), Positives = 31/67 (46%), Gaps = 3/67 (4%)

Query: 228 SNNPKRGKDATPATEQIPLLIEEAEPKDSKNPKRGKIAEVLIFIYEKLKLKQILQPPIIA 287
           S+ P+  K A    +     + +A+ KD K  KR +     I++Y+ LK    + P    
Sbjct: 2   SHMPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQ---VHPDTGI 58

Query: 288 SILAMGI 294
           S  AMGI
Sbjct: 59  SSKAMGI 65


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.325    0.143    0.432 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 12,548,427
Number of Sequences: 62578
Number of extensions: 506023
Number of successful extensions: 1051
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 1046
Number of HSP's gapped (non-prelim): 5
length of query: 442
length of database: 14,973,337
effective HSP length: 102
effective length of query: 340
effective length of database: 8,590,381
effective search space: 2920729540
effective search space used: 2920729540
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 53 (25.0 bits)