Query         013490
Match_columns 442
No_of_seqs    167 out of 395
Neff          4.5 
Searched_HMMs 46136
Date          Fri Mar 29 04:22:54 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/013490.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/013490hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF08192 Peptidase_S64:  Peptid  99.8 1.1E-18 2.3E-23  187.2  12.3  227   43-287   415-686 (695)
  2 TIGR02038 protease_degS peripl  98.2 2.8E-05 6.2E-10   79.5  13.6   93  176-286   147-243 (351)
  3 PRK10898 serine endoprotease;   98.0   7E-05 1.5E-09   76.8  13.2   93  176-286   147-244 (353)
  4 PRK10139 serine endoprotease;   97.9 8.8E-05 1.9E-09   78.7  12.1   89  176-284   161-253 (455)
  5 TIGR02037 degP_htrA_DO peripla  97.9 7.4E-05 1.6E-09   77.9  11.3   91  176-286   128-222 (428)
  6 PRK10942 serine endoprotease;   97.8 0.00021 4.5E-09   76.3  12.0   88  176-283   182-273 (473)
  7 PF13365 Trypsin_2:  Trypsin-li  97.3 0.00092   2E-08   55.3   7.1   24  219-251    97-120 (120)
  8 PF00089 Trypsin:  Trypsin;  In  96.7  0.0077 1.7E-07   54.4   8.6  184   57-284    24-218 (220)
  9 PF00944 Peptidase_S3:  Alphavi  95.6   0.017 3.6E-07   53.1   4.7   47  204-259    82-130 (158)
 10 COG0265 DegQ Trypsin-like seri  95.5    0.12 2.7E-06   52.4  10.8   89  177-285   143-236 (347)
 11 KOG1421 Predicted signaling-as  94.8   0.079 1.7E-06   59.2   7.6   44  227-287   213-256 (955)
 12 cd00190 Tryp_SPc Trypsin-like   93.9     1.6 3.4E-05   39.6  13.0   29  227-257   181-209 (232)
 13 COG3591 V8-like Glu-specific e  92.8     1.4   3E-05   44.2  11.5   28  227-259   200-227 (251)
 14 smart00020 Tryp_SPc Trypsin-li  91.9     3.5 7.6E-05   37.6  12.3   28  228-259   183-210 (229)
 15 PF00947 Pico_P2A:  Picornaviru  91.3    0.21 4.6E-06   45.3   3.5   51  209-283    73-123 (127)
 16 PF00863 Peptidase_C4:  Peptida  91.2     3.7 8.1E-05   40.8  12.4   72  175-259   103-176 (235)
 17 PF05579 Peptidase_S32:  Equine  86.2    0.46 9.9E-06   48.2   2.2   29  225-258   203-231 (297)
 18 PF10459 Peptidase_S46:  Peptid  83.7     1.3 2.8E-05   50.2   4.5   65  212-287   620-684 (698)
 19 PF00949 Peptidase_S7:  Peptida  80.7     1.8   4E-05   39.4   3.5   27  227-258    94-120 (132)
 20 PF12381 Peptidase_C3G:  Tungro  63.9      10 0.00022   37.6   4.5   49  208-261   162-210 (231)
 21 PF01732 DUF31:  Putative pepti  63.0     5.4 0.00012   41.3   2.6   22  228-254   353-374 (374)
 22 PF00548 Peptidase_C3:  3C cyst  58.7      11 0.00023   35.4   3.5   39  213-257   134-172 (172)
 23 KOG1320 Serine protease [Postt  58.3      40 0.00087   36.9   8.1   77  192-285   268-346 (473)
 24 PF02122 Peptidase_S39:  Peptid  35.9      41 0.00089   32.8   3.6   42  227-283   144-185 (203)
 25 KOG1320 Serine protease [Postt  26.2 2.4E+02  0.0051   31.2   7.7   84  132-237   132-217 (473)

No 1  
>PF08192 Peptidase_S64:  Peptidase family S64;  InterPro: IPR012985 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. This family of fungal proteins is involved in the processing of membrane bound transcription factor Stp1 [] and belongs to MEROPS petidase family S64 (clan PA). The processing causes the signalling domain of Stp1 to be passed to the nucleus where several permease genes are induced. The permeases are important for uptake of amino acids, and processing of tp1 only occurs in an amino acid-rich environment. This family is predicted to be distantly related to the trypsin family (MEROPS peptidase family S1) and to have a typical trypsin-like catalytic triad [].
Probab=99.77  E-value=1.1e-18  Score=187.16  Aligned_cols=227  Identities=21%  Similarity=0.270  Sum_probs=139.1

Q ss_pred             CCCCCccccccc-ccceeeeEEEEEeCCC---------CceEEEeecCceeccCCCCCccccCCCCCccCccccC-----
Q 013490           43 DPCIGSGSQVAS-QETYGTLGAIVRSRTG---------NQQVGFLTNRHVAVDLDYPNQKMFHPLPPSLGPGVYL-----  107 (442)
Q Consensus        43 ~p~iG~GisV~~-~~taGTLGclV~D~~G---------~~~~yiLSNnHVla~~n~~~q~~~~~G~pIlQPG~~D-----  107 (442)
                      .|+|+-.+++.+ ...+||||.++.-.-.         .+..|+|||.||+-+.+.+   .   -+.+-.|+..+     
T Consensus       415 ~pPismSis~~~s~k~SGTlGGyi~p~i~~~~~~l~~ya~s~faiTC~HV~l~~~~~---d---yp~Vs~PS~vl~~~Yk  488 (695)
T PF08192_consen  415 SPPISMSISSENSSKSSGTLGGYIYPKIDQKDPKLSSYANSKFAITCAHVCLSESQA---D---YPNVSVPSSVLISLYK  488 (695)
T ss_pred             CCCceEEEeccCCCccccccceeEeeccCccchhHHhhhcccccceeeeEecCcccc---C---CCCcCCchHHHHHHHH
Confidence            366877777765 6689999999942110         1236899999999986531   0   11233454211     


Q ss_pred             ------------CCee------eeeeeeecc-------cccccccCCCCcccccccccccccccccCCCC-cccccc-cc
Q 013490          108 ------------GAVE------RATSFITDD-------LWYGIFAGTNPETFVRADGAFIPFAEDFNLNN-VTTSVK-GV  160 (442)
Q Consensus       108 ------------GG~~------~L~~fIp~~-------~~~~i~~~~~~~n~vDaD~AlI~~A~~~d~s~-vs~~I~-gi  160 (442)
                                  .-.+      .+.+..|..       |...+|.-..-.+..=.|||||.+.+-..-.+ .-..|. ..
T Consensus       489 ~al~~e~~r~~~~~~~~~a~~~e~~~~~~~~~~~~~~~fGqVvwGER~ii~~~LsD~AIIkV~~~~~~~N~LGddi~f~~  568 (695)
T PF08192_consen  489 KALSEEYTRYPEESVEYQAFLQELDRIFPNKKWQPSNKFGQVVWGERSIINKRLSDWAIIKVNKERKCQNYLGDDIQFNE  568 (695)
T ss_pred             HHHHHHHhhccccchHHHHHHHHHHhhccccccCccCccceEEeccchhhcccccceEEEEeCCCceecCCCCccccccC
Confidence                        0000      111211111       12244543333333335999988654221111 111111 11


Q ss_pred             cccCccee-ccCCC-ccccCCCCcEEEeeeecCceeEEEEEEEEEEeCCCCeEEEEEEEEEcCCCCCCCCCCCccceEEe
Q 013490          161 GEIGDVHI-IDLQS-PINSLIGRQVMKVGRSSGLTTGTVMAYALEYNDEKGICFFTDFLVVGENQQTFDLEGDSGSLILL  238 (442)
Q Consensus       161 G~iG~v~~-idl~g-~~~~~lG~~V~KvGRTTGlT~G~I~ai~v~y~~~~G~~~f~dqIIt~~~~~~FS~~GDSGSlVl~  238 (442)
                      -.+...+. ++++- ......|+.|+|+|||||+|+|+|+++.+.||.+ |...+.+|+|.+.....|+.+|||||||+.
T Consensus       569 ~dP~l~f~NlyV~~~~~~~~~G~~VfK~GrTTgyT~G~lNg~klvyw~d-G~i~s~efvV~s~~~~~Fa~~GDSGS~VLt  647 (695)
T PF08192_consen  569 PDPTLMFQNLYVREVVSNLVPGMEVFKVGRTTGYTTGILNGIKLVYWAD-GKIQSSEFVVSSDNNPAFASGGDSGSWVLT  647 (695)
T ss_pred             CCccccccccchhhhhhccCCCCeEEEecccCCccceEecceEEEEecC-CCeEEEEEEEecCCCccccCCCCcccEEEe
Confidence            01100000 11111 2244679999999999999999999999999876 556789999999766899999999999996


Q ss_pred             eccC-CCCCceEEEEEecCCCCCccccccCCCCccceeeechHHHHhhcC
Q 013490          239 TGQN-GEKPRPVGIIWGGTANRGRLKLKVGQPPVNWTSGVDLGRLLDLLE  287 (442)
Q Consensus       239 ~~~~-d~~~~~VGLlfGGs~~~Gr~~~~~g~~~~~~tl~~pI~~VL~~L~  287 (442)
                      +.++ ...-.+|||+++-.+.           ..+|.+|+||..||+.|.
T Consensus       648 k~~d~~~gLgvvGMlhsydge-----------~kqfglftPi~~il~rl~  686 (695)
T PF08192_consen  648 KLEDNNKGLGVVGMLHSYDGE-----------QKQFGLFTPINEILDRLE  686 (695)
T ss_pred             cccccccCceeeEEeeecCCc-----------cceeeccCcHHHHHHHHH
Confidence            5444 3344589999996553           357899999999999875


No 2  
>TIGR02038 protease_degS periplasmic serine pepetdase DegS. This family consists of the periplasmic serine protease DegS (HhoB), a shorter paralog of protease DO (HtrA, DegP) and DegQ (HhoA). It is found in E. coli and several other Proteobacteria of the gamma subdivision. It contains a trypsin domain and a single copy of PDZ domain (in contrast to DegP with two copies). A critical role of this DegS is to sense stress in the periplasm and partially degrade an inhibitor of sigma(E).
Probab=98.16  E-value=2.8e-05  Score=79.49  Aligned_cols=93  Identities=15%  Similarity=0.192  Sum_probs=64.8

Q ss_pred             ccCCCCcEEEeeeecC----ceeEEEEEEEEEEeCCCCeEEEEEEEEEcCCCCCCCCCCCccceEEeeccCCCCCceEEE
Q 013490          176 NSLIGRQVMKVGRSSG----LTTGTVMAYALEYNDEKGICFFTDFLVVGENQQTFDLEGDSGSLILLTGQNGEKPRPVGI  251 (442)
Q Consensus       176 ~~~lG~~V~KvGRTTG----lT~G~I~ai~v~y~~~~G~~~f~dqIIt~~~~~~FS~~GDSGSlVl~~~~~d~~~~~VGL  251 (442)
                      ...+|+.|.-+|...|    +|.|.|+++.-......+   ..+++.+...    -.+|.||..++     |.++++||+
T Consensus       147 ~~~~G~~V~aiG~P~~~~~s~t~GiIs~~~r~~~~~~~---~~~~iqtda~----i~~GnSGGpl~-----n~~G~vIGI  214 (351)
T TIGR02038       147 PPHVGDVVLAIGNPYNLGQTITQGIISATGRNGLSSVG---RQNFIQTDAA----INAGNSGGALI-----NTNGELVGI  214 (351)
T ss_pred             ccCCCCEEEEEeCCCCCCCcEEEEEEEeccCcccCCCC---cceEEEECCc----cCCCCCcceEE-----CCCCeEEEE
Confidence            5789999999999876    478999887732221112   2456666655    57899999999     899999999


Q ss_pred             EEecCCCCCccccccCCCCccceeeechHHHHhhc
Q 013490          252 IWGGTANRGRLKLKVGQPPVNWTSGVDLGRLLDLL  286 (442)
Q Consensus       252 lfGGs~~~Gr~~~~~g~~~~~~tl~~pI~~VL~~L  286 (442)
                      ..+.-...      .+.....+.|+-|++.+...+
T Consensus       215 ~~~~~~~~------~~~~~~g~~faIP~~~~~~vl  243 (351)
T TIGR02038       215 NTASFQKG------GDEGGEGINFAIPIKLAHKIM  243 (351)
T ss_pred             Eeeeeccc------CCCCccceEEEecHHHHHHHH
Confidence            87642211      011234568999998877765


No 3  
>PRK10898 serine endoprotease; Provisional
Probab=98.02  E-value=7e-05  Score=76.83  Aligned_cols=93  Identities=18%  Similarity=0.254  Sum_probs=62.4

Q ss_pred             ccCCCCcEEEeeeecC----ceeEEEEEEE-EEEeCCCCeEEEEEEEEEcCCCCCCCCCCCccceEEeeccCCCCCceEE
Q 013490          176 NSLIGRQVMKVGRSSG----LTTGTVMAYA-LEYNDEKGICFFTDFLVVGENQQTFDLEGDSGSLILLTGQNGEKPRPVG  250 (442)
Q Consensus       176 ~~~lG~~V~KvGRTTG----lT~G~I~ai~-v~y~~~~G~~~f~dqIIt~~~~~~FS~~GDSGSlVl~~~~~d~~~~~VG  250 (442)
                      .+..|+.|.-+|.-.|    .|.|.|++.. ..+.. .+   ..+++.++..    -.+|.||..++     |.++++||
T Consensus       147 ~~~~G~~V~aiG~P~g~~~~~t~Giis~~~r~~~~~-~~---~~~~iqtda~----i~~GnSGGPl~-----n~~G~vvG  213 (353)
T PRK10898        147 VPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLSP-TG---RQNFLQTDAS----INHGNSGGALV-----NSLGELMG  213 (353)
T ss_pred             cCCCCCEEEEEeCCCCcCCCcceeEEEeccccccCC-cc---ccceEEeccc----cCCCCCcceEE-----CCCCeEEE
Confidence            4689999999998766    5889999876 22221 12   1245666655    57899999999     89999999


Q ss_pred             EEEecCCCCCccccccCCCCccceeeechHHHHhhc
Q 013490          251 IIWGGTANRGRLKLKVGQPPVNWTSGVDLGRLLDLL  286 (442)
Q Consensus       251 LlfGGs~~~Gr~~~~~g~~~~~~tl~~pI~~VL~~L  286 (442)
                      |..+.-...+     .+.....+.|+-|++.+...+
T Consensus       214 I~~~~~~~~~-----~~~~~~g~~faIP~~~~~~~~  244 (353)
T PRK10898        214 INTLSFDKSN-----DGETPEGIGFAIPTQLATKIM  244 (353)
T ss_pred             EEEEEecccC-----CCCcccceEEEEchHHHHHHH
Confidence            9875322110     011234678998887755544


No 4  
>PRK10139 serine endoprotease; Provisional
Probab=97.92  E-value=8.8e-05  Score=78.69  Aligned_cols=89  Identities=18%  Similarity=0.148  Sum_probs=61.8

Q ss_pred             ccCCCCcEEEeeeecC----ceeEEEEEEEEEEeCCCCeEEEEEEEEEcCCCCCCCCCCCccceEEeeccCCCCCceEEE
Q 013490          176 NSLIGRQVMKVGRSSG----LTTGTVMAYALEYNDEKGICFFTDFLVVGENQQTFDLEGDSGSLILLTGQNGEKPRPVGI  251 (442)
Q Consensus       176 ~~~lG~~V~KvGRTTG----lT~G~I~ai~v~y~~~~G~~~f~dqIIt~~~~~~FS~~GDSGSlVl~~~~~d~~~~~VGL  251 (442)
                      ...+|+.|.-+|.--|    .|.|.|++++-......   -+.++|.+...    -.+|.||..++     |.++++||+
T Consensus       161 ~~~~G~~V~aiG~P~g~~~tvt~GivS~~~r~~~~~~---~~~~~iqtda~----in~GnSGGpl~-----n~~G~vIGi  228 (455)
T PRK10139        161 KLRVGDFAVAVGNPFGLGQTATSGIISALGRSGLNLE---GLENFIQTDAS----INRGNSGGALL-----NLNGELIGI  228 (455)
T ss_pred             ccCCCCEEEEEecCCCCCCceEEEEEccccccccCCC---CcceEEEECCc----cCCCCCcceEE-----CCCCeEEEE
Confidence            4678999999988555    47888888763211111   14567777765    57899999999     999999999


Q ss_pred             EEecCCCCCccccccCCCCccceeeechHHHHh
Q 013490          252 IWGGTANRGRLKLKVGQPPVNWTSGVDLGRLLD  284 (442)
Q Consensus       252 lfGGs~~~Gr~~~~~g~~~~~~tl~~pI~~VL~  284 (442)
                      ..+--...        +....+.|+-|++.+..
T Consensus       229 ~~~~~~~~--------~~~~gigfaIP~~~~~~  253 (455)
T PRK10139        229 NTAILAPG--------GGSVGIGFAIPSNMART  253 (455)
T ss_pred             EEEEEcCC--------CCccceEEEEEhHHHHH
Confidence            98743221        11235689999865544


No 5  
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family. This family consists of a set proteins various designated DegP, heat shock protein HtrA, and protease DO. The ortholog in Pseudomonas aeruginosa is designated MucD and is found in an operon that controls mucoid phenotype. This family also includes the DegQ (HhoA) paralog in E. coli which can rescue a DegP mutant, but not the smaller DegS paralog, which cannot. Members of this family are located in the periplasm and have separable functions as both protease and chaperone. Members have a trypsin domain and two copies of a PDZ domain. This protein protects bacteria from thermal and other stresses and may be important for the survival of bacterial pathogens.// The chaperone function is dominant at low temperatures, whereas the proteolytic activity is turned on at elevated temperatures.
Probab=97.91  E-value=7.4e-05  Score=77.92  Aligned_cols=91  Identities=18%  Similarity=0.195  Sum_probs=62.1

Q ss_pred             ccCCCCcEEEeeeecC----ceeEEEEEEEEEEeCCCCeEEEEEEEEEcCCCCCCCCCCCccceEEeeccCCCCCceEEE
Q 013490          176 NSLIGRQVMKVGRSSG----LTTGTVMAYALEYNDEKGICFFTDFLVVGENQQTFDLEGDSGSLILLTGQNGEKPRPVGI  251 (442)
Q Consensus       176 ~~~lG~~V~KvGRTTG----lT~G~I~ai~v~y~~~~G~~~f~dqIIt~~~~~~FS~~GDSGSlVl~~~~~d~~~~~VGL  251 (442)
                      ...+|+.|.-+|.--|    +|.|.|+++.-... ..  ..+.+++.++..    -.+|.||+.++     +.++++|||
T Consensus       128 ~~~~G~~v~aiG~p~g~~~~~t~G~vs~~~~~~~-~~--~~~~~~i~tda~----i~~GnSGGpl~-----n~~G~viGI  195 (428)
T TIGR02037       128 KLRVGDWVLAIGNPFGLGQTVTSGIVSALGRSGL-GI--GDYENFIQTDAA----INPGNSGGPLV-----NLRGEVIGI  195 (428)
T ss_pred             CCCCCCEEEEEECCCcCCCcEEEEEEEecccCcc-CC--CCccceEEECCC----CCCCCCCCceE-----CCCCeEEEE
Confidence            4689999999998744    57888888763211 11  124566776665    67899999999     899999999


Q ss_pred             EEecCCCCCccccccCCCCccceeeechHHHHhhc
Q 013490          252 IWGGTANRGRLKLKVGQPPVNWTSGVDLGRLLDLL  286 (442)
Q Consensus       252 lfGGs~~~Gr~~~~~g~~~~~~tl~~pI~~VL~~L  286 (442)
                      ..+.-...       | ....+.|+-|++.+.+.|
T Consensus       196 ~~~~~~~~-------g-~~~g~~faiP~~~~~~~~  222 (428)
T TIGR02037       196 NTAIYSPS-------G-GNVGIGFAIPSNMAKNVV  222 (428)
T ss_pred             EeEEEcCC-------C-CccceEEEEEhHHHHHHH
Confidence            87643321       1 112457888876665544


No 6  
>PRK10942 serine endoprotease; Provisional
Probab=97.77  E-value=0.00021  Score=76.25  Aligned_cols=88  Identities=17%  Similarity=0.210  Sum_probs=59.9

Q ss_pred             ccCCCCcEEEeeeecC----ceeEEEEEEEEEEeCCCCeEEEEEEEEEcCCCCCCCCCCCccceEEeeccCCCCCceEEE
Q 013490          176 NSLIGRQVMKVGRSSG----LTTGTVMAYALEYNDEKGICFFTDFLVVGENQQTFDLEGDSGSLILLTGQNGEKPRPVGI  251 (442)
Q Consensus       176 ~~~lG~~V~KvGRTTG----lT~G~I~ai~v~y~~~~G~~~f~dqIIt~~~~~~FS~~GDSGSlVl~~~~~d~~~~~VGL  251 (442)
                      ...+|+.|.-+|..-|    .|.|.|+++....   .+...+.++|.+...    -.+|.||..++     |.++++|||
T Consensus       182 ~l~~G~~V~aiG~P~g~~~tvt~GiVs~~~r~~---~~~~~~~~~iqtda~----i~~GnSGGpL~-----n~~GeviGI  249 (473)
T PRK10942        182 ALRVGDYTVAIGNPYGLGETVTSGIVSALGRSG---LNVENYENFIQTDAA----INRGNSGGALV-----NLNGELIGI  249 (473)
T ss_pred             ccCCCCEEEEEcCCCCCCcceeEEEEEEeeccc---CCcccccceEEeccc----cCCCCCcCccC-----CCCCeEEEE
Confidence            4689999999998765    4889998877321   111224566777665    56899999999     899999999


Q ss_pred             EEecCCCCCccccccCCCCccceeeechHHHH
Q 013490          252 IWGGTANRGRLKLKVGQPPVNWTSGVDLGRLL  283 (442)
Q Consensus       252 lfGGs~~~Gr~~~~~g~~~~~~tl~~pI~~VL  283 (442)
                      ..+.-...|        ....+.|+-|+..+.
T Consensus       250 ~t~~~~~~g--------~~~g~gfaIP~~~~~  273 (473)
T PRK10942        250 NTAILAPDG--------GNIGIGFAIPSNMVK  273 (473)
T ss_pred             EEEEEcCCC--------CcccEEEEEEHHHHH
Confidence            986432211        012357888875443


No 7  
>PF13365 Trypsin_2:  Trypsin-like peptidase domain; PDB: 1Y8T_A 2Z9I_A 3QO6_A 1L1J_A 1QY6_A 2O8L_A 3OTP_E 2ZLE_I 1KY9_A 3CS0_A ....
Probab=97.28  E-value=0.00092  Score=55.35  Aligned_cols=24  Identities=29%  Similarity=0.484  Sum_probs=20.1

Q ss_pred             EcCCCCCCCCCCCccceEEeeccCCCCCceEEE
Q 013490          219 VGENQQTFDLEGDSGSLILLTGQNGEKPRPVGI  251 (442)
Q Consensus       219 t~~~~~~FS~~GDSGSlVl~~~~~d~~~~~VGL  251 (442)
                      +..+    ..+|.||+.++     +.++++|||
T Consensus        97 ~~~~----~~~G~SGgpv~-----~~~G~vvGi  120 (120)
T PF13365_consen   97 TDAD----TRPGSSGGPVF-----DSDGRVVGI  120 (120)
T ss_dssp             ESSS-----STTTTTSEEE-----ETTSEEEEE
T ss_pred             eecc----cCCCcEeHhEE-----CCCCEEEeC
Confidence            5555    78999999999     899999997


No 8  
>PF00089 Trypsin:  Trypsin;  InterPro: IPR001254 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. This group of serine proteases belong to the MEROPS peptidase family S1 (chymotrypsin family, clan PA(S))and to peptidase family S6 (Hap serine peptidases). The chymotrypsin family is almost totally confined to animals, although trypsin-like enzymes are found in actinomycetes of the genera Streptomyces and Saccharopolyspora, and in the fungus Fusarium oxysporum []. The enzymes are inherently secreted, being synthesised with a signal peptide that targets them to the secretory pathway. Animal enzymes are either secreted directly, packaged into vesicles for regulated secretion, or are retained in leukocyte granules []. The Hap family, 'Haemophilus adhesion and penetration', are proteins that play a role in the interaction with human epithelial cells. The serine protease activity is localized at the N-terminal domain, whereas the binding domain is in the C-terminal region. ; GO: 0004252 serine-type endopeptidase activity, 0006508 proteolysis; PDB: 1SPJ_A 1A5I_A 2ZGH_A 2ZKS_A 2ZGJ_A 2ZGC_A 2ODP_A 2I6Q_A 2I6S_A 2ODQ_A ....
Probab=96.74  E-value=0.0077  Score=54.39  Aligned_cols=184  Identities=16%  Similarity=0.185  Sum_probs=89.9

Q ss_pred             ceeeeEEEEEeCCCCceEEEeecCceeccCCCCCccccCCCCCccCccccCCCeeeeeeeeecccccccccCCCCccccc
Q 013490           57 TYGTLGAIVRSRTGNQQVGFLTNRHVAVDLDYPNQKMFHPLPPSLGPGVYLGAVERATSFITDDLWYGIFAGTNPETFVR  136 (442)
Q Consensus        57 taGTLGclV~D~~G~~~~yiLSNnHVla~~n~~~q~~~~~G~pIlQPG~~DGG~~~L~~fIp~~~~~~i~~~~~~~n~vD  136 (442)
                      ..--.|++|.++      ++||.+|++...+   +.....|...++........-...+++....+       ++.. .+
T Consensus        24 ~~~C~G~li~~~------~vLTaahC~~~~~---~~~v~~g~~~~~~~~~~~~~~~v~~~~~h~~~-------~~~~-~~   86 (220)
T PF00089_consen   24 RFFCTGTLISPR------WVLTAAHCVDGAS---DIKVRLGTYSIRNSDGSEQTIKVSKIIIHPKY-------DPST-YD   86 (220)
T ss_dssp             EEEEEEEEEETT------EEEEEGGGHTSGG---SEEEEESESBTTSTTTTSEEEEEEEEEEETTS-------BTTT-TT
T ss_pred             CeeEeEEecccc------ccccccccccccc---cccccccccccccccccccccccccccccccc-------cccc-cc
Confidence            344557788774      8999999999821   11223343223322111111133343322211       1112 35


Q ss_pred             ccccccccccccCCCCcccccccccccCcceeccCCC-ccccCCCCcEEEeeeecCceeE---EEEEEEEEEeCC-----
Q 013490          137 ADGAFIPFAEDFNLNNVTTSVKGVGEIGDVHIIDLQS-PINSLIGRQVMKVGRSSGLTTG---TVMAYALEYNDE-----  207 (442)
Q Consensus       137 aD~AlI~~A~~~d~s~vs~~I~giG~iG~v~~idl~g-~~~~~lG~~V~KvGRTTGlT~G---~I~ai~v~y~~~-----  207 (442)
                      .|+||+++.+..   .....+..+.         +.. ......|+.+.-+|.......+   .+....+.+-..     
T Consensus        87 ~DiAll~L~~~~---~~~~~~~~~~---------l~~~~~~~~~~~~~~~~G~~~~~~~~~~~~~~~~~~~~~~~~~c~~  154 (220)
T PF00089_consen   87 NDIALLKLDRPI---TFGDNIQPIC---------LPSAGSDPNVGTSCIVVGWGRTSDNGYSSNLQSVTVPVVSRKTCRS  154 (220)
T ss_dssp             TSEEEEEESSSS---EHBSSBEESB---------BTSTTHTTTTTSEEEEEESSBSSTTSBTSBEEEEEEEEEEHHHHHH
T ss_pred             cccccccccccc---cccccccccc---------cccccccccccccccccccccccccccccccccccccccccccccc
Confidence            688997766431   2222222221         111 1223677777777776654444   444444322110     


Q ss_pred             --CCeEEEEEEEEEcCCCCCCCCCCCccceEEeeccCCCCCceEEEEEecCCCCCccccccCCCCccceeeechHHHHh
Q 013490          208 --KGICFFTDFLVVGENQQTFDLEGDSGSLILLTGQNGEKPRPVGIIWGGTANRGRLKLKVGQPPVNWTSGVDLGRLLD  284 (442)
Q Consensus       208 --~G~~~f~dqIIt~~~~~~FS~~GDSGSlVl~~~~~d~~~~~VGLlfGGs~~~Gr~~~~~g~~~~~~tl~~pI~~VL~  284 (442)
                        ... ....++-+..++..-.-.|||||.++.     .+..++|++..+....         .+....+|++|...++
T Consensus       155 ~~~~~-~~~~~~c~~~~~~~~~~~g~sG~pl~~-----~~~~lvGI~s~~~~c~---------~~~~~~v~~~v~~~~~  218 (220)
T PF00089_consen  155 SYNDN-LTPNMICAGSSGSGDACQGDSGGPLIC-----NNNYLVGIVSFGENCG---------SPNYPGVYTRVSSYLD  218 (220)
T ss_dssp             HTTTT-STTTEEEEETTSSSBGGTTTTTSEEEE-----TTEEEEEEEEEESSSS---------BTTSEEEEEEGGGGHH
T ss_pred             ccccc-ccccccccccccccccccccccccccc-----ceeeecceeeecCCCC---------CCCcCEEEEEHHHhhc
Confidence              000 111222222211122457999999993     3337999999983322         1112388888887654


No 9  
>PF00944 Peptidase_S3:  Alphavirus core protein ;  InterPro: IPR000930 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. Togavirin, also known as Sindbis virus core endopeptidase, is a serine protease resident at the N terminus of the p130 polyprotein of togaviruses []. The endopeptidase signature identifies the peptidase as belonging to the MEROPS peptidase family S3 (togavirin family, clan PA(S)). The polyprotein also includes structural proteins for the nucleocapsid core and for the glycoprotein spikes []. Togavirin is only active while part of the polyprotein, cleavage at a Trp-Ser bond resulting in total lack of activity []. Mutagenesis studies have identified the location of the His-Asp-Ser catalytic triad, and X-ray studies have revealed the protein fold to be similar to that of chymotrypsin [, ].; GO: 0004252 serine-type endopeptidase activity, 0006508 proteolysis, 0016020 membrane; PDB: 2YEW_D 1EP5_A 3J0C_F 1EP6_C 1WYK_D 1DYL_A 1VCQ_B 1VCP_B 1LD4_D 1KXA_A ....
Probab=95.64  E-value=0.017  Score=53.12  Aligned_cols=47  Identities=30%  Similarity=0.494  Sum_probs=35.3

Q ss_pred             EeCCCCeEEEEE--EEEEcCCCCCCCCCCCccceEEeeccCCCCCceEEEEEecCCCC
Q 013490          204 YNDEKGICFFTD--FLVVGENQQTFDLEGDSGSLILLTGQNGEKPRPVGIIWGGTANR  259 (442)
Q Consensus       204 y~~~~G~~~f~d--qIIt~~~~~~FS~~GDSGSlVl~~~~~d~~~~~VGLlfGGs~~~  259 (442)
                      ||...|...|++  +.|-+..    ..+||||..++     |.++++||+++||....
T Consensus        82 YNwhhGaVqy~~grftip~g~----g~~GDSGRpi~-----DNsGrVVaIVLGG~neG  130 (158)
T PF00944_consen   82 YNWHHGAVQYSNGRFTIPTGV----GKPGDSGRPIF-----DNSGRVVAIVLGGANEG  130 (158)
T ss_dssp             EEETTEEEEEETTEEEEETTS-----STTSTTEEEE-----STTSBEEEEEEEEEEET
T ss_pred             eccccceEEEeCCeEEeccCC----CCCCCCCCccC-----cCCCCEEEEEecCCCCC
Confidence            455556555654  4454555    78999999999     99999999999998764


No 10 
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones]
Probab=95.46  E-value=0.12  Score=52.40  Aligned_cols=89  Identities=20%  Similarity=0.280  Sum_probs=60.8

Q ss_pred             cCCCCcEEEeeeecC----ceeEEEEEEEEE-EeCCCCeEEEEEEEEEcCCCCCCCCCCCccceEEeeccCCCCCceEEE
Q 013490          177 SLIGRQVMKVGRSSG----LTTGTVMAYALE-YNDEKGICFFTDFLVVGENQQTFDLEGDSGSLILLTGQNGEKPRPVGI  251 (442)
Q Consensus       177 ~~lG~~V~KvGRTTG----lT~G~I~ai~v~-y~~~~G~~~f~dqIIt~~~~~~FS~~GDSGSlVl~~~~~d~~~~~VGL  251 (442)
                      ..+|+.|.-+|-..|    +|.|.|+++.-. +.....   +.++|.+...    -.+|.||..++     +.+++.||+
T Consensus       143 l~vg~~v~aiGnp~g~~~tvt~Givs~~~r~~v~~~~~---~~~~IqtdAa----in~gnsGgpl~-----n~~g~~iGi  210 (347)
T COG0265         143 LRVGDVVVAIGNPFGLGQTVTSGIVSALGRTGVGSAGG---YVNFIQTDAA----INPGNSGGPLV-----NIDGEVVGI  210 (347)
T ss_pred             cccCCEEEEecCCCCcccceeccEEeccccccccCccc---ccchhhcccc----cCCCCCCCceE-----cCCCcEEEE
Confidence            348898888888888    677777777643 322111   6677765544    68999999999     899999998


Q ss_pred             EEecCCCCCccccccCCCCccceeeechHHHHhh
Q 013490          252 IWGGTANRGRLKLKVGQPPVNWTSGVDLGRLLDL  285 (442)
Q Consensus       252 lfGGs~~~Gr~~~~~g~~~~~~tl~~pI~~VL~~  285 (442)
                      ..+.-...+.        .....|+-|+..+...
T Consensus       211 nt~~~~~~~~--------~~gigfaiP~~~~~~v  236 (347)
T COG0265         211 NTAIIAPSGG--------SSGIGFAIPVNLVAPV  236 (347)
T ss_pred             EEEEecCCCC--------cceeEEEecHHHHHHH
Confidence            8876654310        1224677777665543


No 11 
>KOG1421 consensus Predicted signaling-associated protein (contains a PDZ domain) [General function prediction only]
Probab=94.80  E-value=0.079  Score=59.24  Aligned_cols=44  Identities=23%  Similarity=0.244  Sum_probs=38.7

Q ss_pred             CCCCCccceEEeeccCCCCCceEEEEEecCCCCCccccccCCCCccceeeechHHHHhhcC
Q 013490          227 DLEGDSGSLILLTGQNGEKPRPVGIIWGGTANRGRLKLKVGQPPVNWTSGVDLGRLLDLLE  287 (442)
Q Consensus       227 S~~GDSGSlVl~~~~~d~~~~~VGLlfGGs~~~Gr~~~~~g~~~~~~tl~~pI~~VL~~L~  287 (442)
                      +.+|-|||.++     +-.+++|+|.-||....+            .++|-||.+|+++|-
T Consensus       213 tsggssgspVv-----~i~gyAVAl~agg~~ssa------------s~ffLpLdrV~RaL~  256 (955)
T KOG1421|consen  213 TSGGSSGSPVV-----DIPGYAVALNAGGSISSA------------SDFFLPLDRVVRALR  256 (955)
T ss_pred             CCCCCCCCcee-----cccceEEeeecCCccccc------------ccceeeccchhhhhh
Confidence            78899999999     899999999999988652            389999999998774


No 12 
>cd00190 Tryp_SPc Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms. Alignment contains also inactive enzymes that have substitutions of the catalytic triad residues.
Probab=93.88  E-value=1.6  Score=39.58  Aligned_cols=29  Identities=28%  Similarity=0.446  Sum_probs=21.5

Q ss_pred             CCCCCccceEEeeccCCCCCceEEEEEecCC
Q 013490          227 DLEGDSGSLILLTGQNGEKPRPVGIIWGGTA  257 (442)
Q Consensus       227 S~~GDSGSlVl~~~~~d~~~~~VGLlfGGs~  257 (442)
                      .-+||||+.++..  .+...+++|++..|..
T Consensus       181 ~c~gdsGgpl~~~--~~~~~~lvGI~s~g~~  209 (232)
T cd00190         181 ACQGDSGGPLVCN--DNGRGVLVGIVSWGSG  209 (232)
T ss_pred             cccCCCCCcEEEE--eCCEEEEEEEEehhhc
Confidence            4569999999952  1244789999988764


No 13 
>COG3591 V8-like Glu-specific endopeptidase [Amino acid transport and metabolism]
Probab=92.82  E-value=1.4  Score=44.25  Aligned_cols=28  Identities=32%  Similarity=0.542  Sum_probs=24.5

Q ss_pred             CCCCCccceEEeeccCCCCCceEEEEEecCCCC
Q 013490          227 DLEGDSGSLILLTGQNGEKPRPVGIIWGGTANR  259 (442)
Q Consensus       227 S~~GDSGSlVl~~~~~d~~~~~VGLlfGGs~~~  259 (442)
                      ..||+|||.++     ..+.+++|++++|-.-.
T Consensus       200 T~pG~SGSpv~-----~~~~~vigv~~~g~~~~  227 (251)
T COG3591         200 TLPGSSGSPVL-----ISKDEVIGVHYNGPGAN  227 (251)
T ss_pred             ccCCCCCCceE-----ecCceEEEEEecCCCcc
Confidence            68999999999     56779999999998744


No 14 
>smart00020 Tryp_SPc Trypsin-like serine protease. Many of these are synthesised as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms. A few, however, are active as single chain molecules, and others are inactive due to substitutions of the catalytic triad residues.
Probab=91.86  E-value=3.5  Score=37.64  Aligned_cols=28  Identities=32%  Similarity=0.456  Sum_probs=20.8

Q ss_pred             CCCCccceEEeeccCCCCCceEEEEEecCCCC
Q 013490          228 LEGDSGSLILLTGQNGEKPRPVGIIWGGTANR  259 (442)
Q Consensus       228 ~~GDSGSlVl~~~~~d~~~~~VGLlfGGs~~~  259 (442)
                      -+||||+.++...  + ..+++|++..|. .+
T Consensus       183 c~gdsG~pl~~~~--~-~~~l~Gi~s~g~-~C  210 (229)
T smart00020      183 CQGDSGGPLVCND--G-RWVLVGIVSWGS-GC  210 (229)
T ss_pred             cCCCCCCeeEEEC--C-CEEEEEEEEECC-CC
Confidence            4599999999521  1 458999998887 44


No 15 
>PF00947 Pico_P2A:  Picornavirus core protein 2A;  InterPro: IPR000081 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Cysteine peptidases have characteristic molecular topologies, which can be seen not only in their three-dimensional structures, but commonly also in the two-dimensional structures. These are peptidases in which the nucleophile is the sulphydryl group of a cysteine residue. Cysteine proteases are divided into clans (proteins which are evolutionary related), and further sub-divided into families, on the basis of the architecture of their catalytic dyad or triad [].  This domain defines cysteine peptidases belong to MEROPS peptidase family C3 (picornain, clan PA(C)), subfamilies 3CA and 3CB. The protein fold of this peptidase domain for members of this family resembles that of the serine peptidase, chymotrypsin [], the type example for clan PA. Picornaviral proteins are expressed as a single polyprotein which is cleaved by the viral 3C cysteine protease []. The poliovirus polyprotein is selectively cleaved between the Gln-|-Gly bond. In other picornavirus reactions Glu may be substituted for Gln, and Ser or Thr for Gly. ; GO: 0008233 peptidase activity, 0006508 proteolysis, 0016032 viral reproduction; PDB: 2HRV_B 1Z8R_A.
Probab=91.30  E-value=0.21  Score=45.26  Aligned_cols=51  Identities=22%  Similarity=0.303  Sum_probs=38.1

Q ss_pred             CeEEEEEEEEEcCCCCCCCCCCCccceEEeeccCCCCCceEEEEEecCCCCCccccccCCCCccceeeechHHHH
Q 013490          209 GICFFTDFLVVGENQQTFDLEGDSGSLILLTGQNGEKPRPVGIIWGGTANRGRLKLKVGQPPVNWTSGVDLGRLL  283 (442)
Q Consensus       209 G~~~f~dqIIt~~~~~~FS~~GDSGSlVl~~~~~d~~~~~VGLlfGGs~~~Gr~~~~~g~~~~~~tl~~pI~~VL  283 (442)
                      .+.+.++.++...+    ++|||-|++++      -+.-++||+-||....              ..|.+|+.++
T Consensus        73 P~h~Q~~~l~g~Gp----~~PGdCGg~L~------C~HGViGi~Tagg~g~--------------VaF~dir~~~  123 (127)
T PF00947_consen   73 PKHYQYNLLIGEGP----AEPGDCGGILR------CKHGVIGIVTAGGEGH--------------VAFADIRDLL  123 (127)
T ss_dssp             -SEEEECEEEEE-S----SSTT-TCSEEE------ETTCEEEEEEEEETTE--------------EEEEECCCGS
T ss_pred             hhheecCceeeccc----CCCCCCCceeE------eCCCeEEEEEeCCCce--------------EEEEechhhh
Confidence            35678888887776    99999999998      3455999999998754              7788877653


No 16 
>PF00863 Peptidase_C4:  Peptidase family C4 This family belongs to family C4 of the peptidase classification.;  InterPro: IPR001730 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Cysteine peptidases have characteristic molecular topologies, which can be seen not only in their three-dimensional structures, but commonly also in the two-dimensional structures. These are peptidases in which the nucleophile is the sulphydryl group of a cysteine residue. Cysteine proteases are divided into clans (proteins which are evolutionary related), and further sub-divided into families, on the basis of the architecture of their catalytic dyad or triad [].  Nuclear inclusion A (NIA) proteases from potyviruses are cysteine peptidases belong to the MEROPS peptidase family C4 (NIa protease family, clan PA(C)) [, ].  Potyviruses include plant viruses in which the single-stranded RNA encodes a polyprotein with NIA protease activity, where proteolytic cleavage is specific for Gln+Gly sites. The NIA protease acts on the polyprotein, releasing itself by Gln+Gly cleavage at both the N- and C-termini. It further processes the polyprotein by cleavage at five similar sites in the C-terminal half of the sequence. In addition to its C-terminal protease activity, the NIA protease contains an N-terminal domain that has been implicated in the transcription process []. This peptidase is present in the nuclear inclusion protein of potyviruses.; GO: 0008234 cysteine-type peptidase activity, 0006508 proteolysis; PDB: 3MMG_B 1Q31_B 1LVB_A 1LVM_A.
Probab=91.20  E-value=3.7  Score=40.84  Aligned_cols=72  Identities=21%  Similarity=0.274  Sum_probs=46.2

Q ss_pred             cccCCCCcEEEeee--ecCceeEEEEEEEEEEeCCCCeEEEEEEEEEcCCCCCCCCCCCccceEEeeccCCCCCceEEEE
Q 013490          175 INSLIGRQVMKVGR--SSGLTTGTVMAYALEYNDEKGICFFTDFLVVGENQQTFDLEGDSGSLILLTGQNGEKPRPVGII  252 (442)
Q Consensus       175 ~~~~lG~~V~KvGR--TTGlT~G~I~ai~v~y~~~~G~~~f~dqIIt~~~~~~FS~~GDSGSlVl~~~~~d~~~~~VGLl  252 (442)
                      ..|..++.|+.+|-  .+....-+|+.-...|.... ..+.+.+|-        +..||=|+.++.    -..+.+||+|
T Consensus       103 R~P~~~e~v~mVg~~fq~k~~~s~vSesS~i~p~~~-~~fWkHwIs--------Tk~G~CG~PlVs----~~Dg~IVGiH  169 (235)
T PF00863_consen  103 RAPKEGERVCMVGSNFQEKSISSTVSESSWIYPEEN-SHFWKHWIS--------TKDGDCGLPLVS----TKDGKIVGIH  169 (235)
T ss_dssp             ----TT-EEEEEEEECSSCCCEEEEEEEEEEEEETT-TTEEEE-C-----------TT-TT-EEEE----TTT--EEEEE
T ss_pred             cCCCCCCEEEEEEEEEEcCCeeEEECCceEEeecCC-CCeeEEEec--------CCCCccCCcEEE----cCCCcEEEEE
Confidence            36899999999986  77777888888876666332 236777765        456999999995    5788999999


Q ss_pred             EecCCCC
Q 013490          253 WGGTANR  259 (442)
Q Consensus       253 fGGs~~~  259 (442)
                      ..++...
T Consensus       170 sl~~~~~  176 (235)
T PF00863_consen  170 SLTSNTS  176 (235)
T ss_dssp             EEEETTT
T ss_pred             cCccCCC
Confidence            9988765


No 17 
>PF05579 Peptidase_S32:  Equine arteritis virus serine endopeptidase S32;  InterPro: IPR008760 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. This group of serine peptidases belong to MEROPS peptidase family S32 (clan PA(S)). The type example is equine arteritis virus serine endopeptidase (equine arteritis virus), which is involved in processing of nidovirus polyproteins [].; GO: 0004252 serine-type endopeptidase activity, 0016032 viral reproduction, 0019082 viral protein processing; PDB: 3FAN_A 3FAO_A 1MBM_A.
Probab=86.20  E-value=0.46  Score=48.22  Aligned_cols=29  Identities=31%  Similarity=0.459  Sum_probs=22.4

Q ss_pred             CCCCCCCccceEEeeccCCCCCceEEEEEecCCC
Q 013490          225 TFDLEGDSGSLILLTGQNGEKPRPVGIIWGGTAN  258 (442)
Q Consensus       225 ~FS~~GDSGSlVl~~~~~d~~~~~VGLlfGGs~~  258 (442)
                      -|+.+|||||.++     .+.+.+||+|-|.+..
T Consensus       203 ~fT~~GDSGSPVV-----t~dg~liGVHTGSn~~  231 (297)
T PF05579_consen  203 CFTGPGDSGSPVV-----TEDGDLIGVHTGSNKR  231 (297)
T ss_dssp             ESS-GGCTT-EEE-----ETTC-EEEEEEEEETT
T ss_pred             EEcCCCCCCCccC-----cCCCCEEEEEecCCCc
Confidence            4889999999999     6889999999996653


No 18 
>PF10459 Peptidase_S46:  Peptidase S46;  InterPro: IPR019500 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. This entry represents S46 peptidases, where dipeptidyl-peptidase 7 (DPP-7) is the best-characterised member of this family. It is a serine peptidase that is located on the cell surface and is predicted to have two N-terminal transmembrane domains. 
Probab=83.73  E-value=1.3  Score=50.19  Aligned_cols=65  Identities=28%  Similarity=0.359  Sum_probs=46.0

Q ss_pred             EEEEEEEEcCCCCCCCCCCCccceEEeeccCCCCCceEEEEEecCCCCCccccccCCCCccceeeechHHHHhhcC
Q 013490          212 FFTDFLVVGENQQTFDLEGDSGSLILLTGQNGEKPRPVGIIWGGTANRGRLKLKVGQPPVNWTSGVDLGRLLDLLE  287 (442)
Q Consensus       212 ~f~dqIIt~~~~~~FS~~GDSGSlVl~~~~~d~~~~~VGLlfGGs~~~Gr~~~~~g~~~~~~tl~~pI~~VL~~L~  287 (442)
                      +--||+-+.+     .-+|-|||.++     |.++++|||.|-|+-..=-.-+.. .+..+.++..+|.-||-.|+
T Consensus       620 ~pv~FlstnD-----itGGNSGSPvl-----N~~GeLVGl~FDgn~Esl~~D~~f-dp~~~R~I~VDiRyvL~~ld  684 (698)
T PF10459_consen  620 VPVNFLSTND-----ITGGNSGSPVL-----NAKGELVGLAFDGNWESLSGDIAF-DPELNRTIHVDIRYVLWALD  684 (698)
T ss_pred             eeeEEEeccC-----cCCCCCCCccC-----CCCceEEEEeecCchhhccccccc-ccccceeEEEEHHHHHHHHH
Confidence            3446666555     57899999999     999999999999985430001111 13347799999999988763


No 19 
>PF00949 Peptidase_S7:  Peptidase S7, Flavivirus NS3 serine protease ;  InterPro: IPR001850 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. This signature identifies serine peptidases belong to MEROPS peptidase family S7 (flavivirin family, clan PA(S)). The protein fold of the peptidase domain for members of this family resembles that of chymotrypsin, the type example for clan PA.  Flaviviruses produce a polyprotein from the ssRNA genome. The N terminus of the NS3 protein (approx. 180 aa) is required for the processing of the polyprotein. NS3 also has conserved homology with NTP-binding proteins and DEAD family of RNA helicase [, , ].; GO: 0003723 RNA binding, 0003724 RNA helicase activity, 0005524 ATP binding; PDB: 2IJO_B 3E90_D 2GGV_B 2FP7_B 2WV9_A 3U1I_B 3U1J_B 2WZQ_A 2WHX_A 3L6P_A ....
Probab=80.66  E-value=1.8  Score=39.45  Aligned_cols=27  Identities=30%  Similarity=0.349  Sum_probs=21.6

Q ss_pred             CCCCCccceEEeeccCCCCCceEEEEEecCCC
Q 013490          227 DLEGDSGSLILLTGQNGEKPRPVGIIWGGTAN  258 (442)
Q Consensus       227 S~~GDSGSlVl~~~~~d~~~~~VGLlfGGs~~  258 (442)
                      -.+|-|||+++     +.++++|||+++|-..
T Consensus        94 ~~~GsSGSpi~-----n~~g~ivGlYg~g~~~  120 (132)
T PF00949_consen   94 FPKGSSGSPIF-----NQNGEIVGLYGNGVEV  120 (132)
T ss_dssp             S-TTGTT-EEE-----ETTSCEEEEEEEEEE-
T ss_pred             cCCCCCCCceE-----cCCCcEEEEEccceee
Confidence            36799999999     8999999999998653


No 20 
>PF12381 Peptidase_C3G:  Tungro spherical virus-type peptidase;  InterPro: IPR024387 This entry represents a rice tungro spherical waikavirus-type peptidase that belongs to MEROPS peptidase family C3G. It is a picornain 3C-type protease, and is responsible for the self-cleavage of the positive single-stranded polyproteins of a number of plant viral genomes. The location of the protease activity of the polyprotein is at the C-terminal end, adjacent and N-terminal to the putative RNA polymerase [, ].
Probab=63.92  E-value=10  Score=37.62  Aligned_cols=49  Identities=29%  Similarity=0.298  Sum_probs=31.5

Q ss_pred             CCeEEEEEEEEEcCCCCCCCCCCCccceEEeeccCCCCCceEEEEEecCCCCCc
Q 013490          208 KGICFFTDFLVVGENQQTFDLEGDSGSLILLTGQNGEKPRPVGIIWGGTANRGR  261 (442)
Q Consensus       208 ~G~~~f~dqIIt~~~~~~FS~~GDSGSlVl~~~~~d~~~~~VGLlfGGs~~~Gr  261 (442)
                      +|..+.+.-+-...+    +..||=||++++- +...-..++|||.+|..+.++
T Consensus       162 ~~~ytir~gleY~~~----t~~GdCGs~i~~~-~t~~~RKIvGiHVAG~~~~~~  210 (231)
T PF12381_consen  162 KGQYTIRQGLEYQMP----TMNGDCGSPIVRN-NTQMVRKIVGIHVAGSANHAM  210 (231)
T ss_pred             CCcEEeeeeeeEECC----CcCCCccceeeEc-chhhhhhhheeeecccccccc
Confidence            344444443333333    8999999999962 111234589999999986644


No 21 
>PF01732 DUF31:  Putative peptidase (DUF31);  InterPro: IPR022382  This domain has no known function. It is found in various hypothetical proteins and putative lipoproteins from mycoplasmas. 
Probab=63.01  E-value=5.4  Score=41.29  Aligned_cols=22  Identities=36%  Similarity=0.673  Sum_probs=20.6

Q ss_pred             CCCCccceEEeeccCCCCCceEEEEEe
Q 013490          228 LEGDSGSLILLTGQNGEKPRPVGIIWG  254 (442)
Q Consensus       228 ~~GDSGSlVl~~~~~d~~~~~VGLlfG  254 (442)
                      .+|=|||+|+     ++++++|||+||
T Consensus       353 ~gGaSGS~V~-----n~~~~lvGIy~g  374 (374)
T PF01732_consen  353 GGGASGSMVI-----NQNNELVGIYFG  374 (374)
T ss_pred             CCCCCcCeEE-----CCCCCEEEEeCC
Confidence            5899999999     999999999997


No 22 
>PF00548 Peptidase_C3:  3C cysteine protease (picornain 3C);  InterPro: IPR000199 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Cysteine peptidases have characteristic molecular topologies, which can be seen not only in their three-dimensional structures, but commonly also in the two-dimensional structures. These are peptidases in which the nucleophile is the sulphydryl group of a cysteine residue. Cysteine proteases are divided into clans (proteins which are evolutionary related), and further sub-divided into families, on the basis of the architecture of their catalytic dyad or triad [].  This signature defines cysteine peptidases belong to MEROPS peptidase family C3 (picornain, clan PA(C)), subfamilies C3A and C3B. The protein fold of this peptidase domain for members of this family resembles that of the serine peptidase, chymotrypsin [], the type example for clan PA. Picornaviral proteins are expressed as a single polyprotein which is cleaved by the viral C3 cysteine protease. The poliovirus polyprotein is selectively cleaved between the Gln-|-Gly bond. In other picornavirus reactions Glu may be substituted for Gln, and Ser or Thr for Gly. ; GO: 0004197 cysteine-type endopeptidase activity, 0006508 proteolysis; PDB: 3SJO_E 2H6M_A 1QA7_C 1HAV_B 2HAL_A 2H9H_A 3QZQ_B 3QZR_A 3R0F_B 3SJ9_A ....
Probab=58.65  E-value=11  Score=35.41  Aligned_cols=39  Identities=21%  Similarity=0.206  Sum_probs=28.6

Q ss_pred             EEEEEEEcCCCCCCCCCCCccceEEeeccCCCCCceEEEEEecCC
Q 013490          213 FTDFLVVGENQQTFDLEGDSGSLILLTGQNGEKPRPVGIIWGGTA  257 (442)
Q Consensus       213 f~dqIIt~~~~~~FS~~GDSGSlVl~~~~~d~~~~~VGLlfGGs~  257 (442)
                      +...+....+    +.+||-||+++..  ......++|||.||++
T Consensus       134 ~~~~~~Y~~~----t~~G~CG~~l~~~--~~~~~~i~GiHvaG~G  172 (172)
T PF00548_consen  134 TPRSLKYKAP----TKPGMCGSPLVSR--IGGQGKIIGIHVAGNG  172 (172)
T ss_dssp             EEEEEEEESE----EETTGTTEEEEES--CGGTTEEEEEEEEEES
T ss_pred             eeEEEEEccC----CCCCccCCeEEEe--eccCccEEEEEeccCC
Confidence            4445555555    7789999999952  3447889999999963


No 23 
>KOG1320 consensus Serine protease [Posttranslational modification, protein turnover, chaperones]
Probab=58.27  E-value=40  Score=36.93  Aligned_cols=77  Identities=14%  Similarity=0.085  Sum_probs=45.4

Q ss_pred             ceeEEEEEEEEEEeCCCCe--EEEEEEEEEcCCCCCCCCCCCccceEEeeccCCCCCceEEEEEecCCCCCccccccCCC
Q 013490          192 LTTGTVMAYALEYNDEKGI--CFFTDFLVVGENQQTFDLEGDSGSLILLTGQNGEKPRPVGIIWGGTANRGRLKLKVGQP  269 (442)
Q Consensus       192 lT~G~I~ai~v~y~~~~G~--~~f~dqIIt~~~~~~FS~~GDSGSlVl~~~~~d~~~~~VGLlfGGs~~~Gr~~~~~g~~  269 (442)
                      +|.|.+++..-.....+..  .+..+.+-+..-    ...|-||-++|     +..+.+||+.|.--...|-..      
T Consensus       268 ~t~g~vs~~~R~~~~lg~~~g~~i~~~~qtd~a----i~~~nsg~~ll-----~~DG~~IgVn~~~~~ri~~~~------  332 (473)
T KOG1320|consen  268 LTQGMVSGQLRKSFKLGLETGVLISKINQTDAA----INPGNSGGPLL-----NLDGEVIGVNTRKVTRIGFSH------  332 (473)
T ss_pred             eeecccccccccccccCcccceeeeeecccchh----hhcccCCCcEE-----EecCcEeeeeeeeeEEeeccc------
Confidence            3555555544222222222  344455555544    78899999999     889999997776544221112      


Q ss_pred             CccceeeechHHHHhh
Q 013490          270 PVNWTSGVDLGRLLDL  285 (442)
Q Consensus       270 ~~~~tl~~pI~~VL~~  285 (442)
                        -.++.-|+..|+..
T Consensus       333 --~iSf~~p~d~vl~~  346 (473)
T KOG1320|consen  333 --GISFKIPIDTVLVI  346 (473)
T ss_pred             --cceeccCchHhhhh
Confidence              23777888887763


No 24 
>PF02122 Peptidase_S39:  Peptidase S39;  InterPro: IPR000382 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. ORF2 of Potato leafroll virus (PLrV) encodes a polyprotein which is translated following a -1 frameshift. The polyprotein has a putative linear arrangement of membrane achor-VPg-peptidase-polmerase domains. The serine peptidase domain which is found in this group of sequences belongs to MEROPS peptidase family S39 (clan PA(S)). It is likely that the peptidase domain is involved in the cleavage of the polyprotein []. The nucleotide sequence for the RNA of PLrV has been determined [, ]. The sequence contains six large open reading frames (ORFs). The 5' coding region encodes two polypeptides of 28K and 70K, which overlap in different reading frames; it is suggested that the third ORF in the 5' block is translated by frameshift readthrough near the end of the 70K protein, yielding a 118K polypeptide []. Segments of the predicted amino acid sequences of these ORFs resemble those of known viral RNA polymerases, ATP-binding proteins and viral genome-linked proteins. The nucleotide sequence of the genomic RNA of Beet western yellows virus (BWYV) has been determined []. The sequence contains six long ORFs. A cluster of three of these ORFs, including the coat protein cistron, display extensive amino acid sequence similarity to corresponding ORFs of a second luteovirus: Barley yellow dwarf virus [].; GO: 0004252 serine-type endopeptidase activity, 0022415 viral reproductive process, 0016021 integral to membrane; PDB: 1ZYO_A.
Probab=35.88  E-value=41  Score=32.80  Aligned_cols=42  Identities=21%  Similarity=0.178  Sum_probs=15.1

Q ss_pred             CCCCCccceEEeeccCCCCCceEEEEEecCCCCCccccccCCCCccceeeechHHHH
Q 013490          227 DLEGDSGSLILLTGQNGEKPRPVGIIWGGTANRGRLKLKVGQPPVNWTSGVDLGRLL  283 (442)
Q Consensus       227 S~~GDSGSlVl~~~~~d~~~~~VGLlfGGs~~~Gr~~~~~g~~~~~~tl~~pI~~VL  283 (442)
                      +.+|+||+-++     ..+ ..||+|-|...         +...+||-+..||..+.
T Consensus       144 T~~G~SGtp~y-----~g~-~vvGvH~G~~~---------~~~~~n~n~~spip~~~  185 (203)
T PF02122_consen  144 TSPGWSGTPYY-----SGK-NVVGVHTGSPS---------GSNRENNNRMSPIPPIP  185 (203)
T ss_dssp             --TT-TT-EEE------SS--EEEEEEEE----------------------------
T ss_pred             CCCCCCCCCeE-----ECC-CceEeecCccc---------ccccccccccccccccc
Confidence            78999999999     344 89999999511         12335667777776664


No 25 
>KOG1320 consensus Serine protease [Posttranslational modification, protein turnover, chaperones]
Probab=26.25  E-value=2.4e+02  Score=31.19  Aligned_cols=84  Identities=15%  Similarity=0.137  Sum_probs=46.9

Q ss_pred             cccccccccccccccccCCCCcccc-cccccccCcceeccCCCccccCCCCcEEEe-eeecCceeEEEEEEEEEEeCCCC
Q 013490          132 ETFVRADGAFIPFAEDFNLNNVTTS-VKGVGEIGDVHIIDLQSPINSLIGRQVMKV-GRSSGLTTGTVMAYALEYNDEKG  209 (442)
Q Consensus       132 ~n~vDaD~AlI~~A~~~d~s~vs~~-I~giG~iG~v~~idl~g~~~~~lG~~V~Kv-GRTTGlT~G~I~ai~v~y~~~~G  209 (442)
                      .++..||.|++.+.   ....|-.- -...|++             |.+...|+=+ |-+.=+|.|.|.++..+-...++
T Consensus       132 ~~~~~cd~Avv~Ie---~~~f~~~~~~~e~~~i-------------p~l~~S~~Vv~gd~i~VTnghV~~~~~~~y~~~~  195 (473)
T KOG1320|consen  132 AVFEECDLAVVYIE---SEEFWKGMNPFELGDI-------------PSLNGSGFVVGGDGIIVTNGHVVRVEPRIYAHSS  195 (473)
T ss_pred             HhhhcccceEEEEe---eccccCCCcccccCCC-------------cccCccEEEEcCCcEEEEeeEEEEEEeccccCCC
Confidence            36678988986543   22333321 1333443             3333333322 45555899999999955444445


Q ss_pred             eEEEEEEEEEcCCCCCCCCCCCccceEE
Q 013490          210 ICFFTDFLVVGENQQTFDLEGDSGSLIL  237 (442)
Q Consensus       210 ~~~f~dqIIt~~~~~~FS~~GDSGSlVl  237 (442)
                      ..+..-||-...      .+|.||-..+
T Consensus       196 ~~l~~vqi~aa~------~~~~s~ep~i  217 (473)
T KOG1320|consen  196 TVLLRVQIDAAI------GPGNSGEPVI  217 (473)
T ss_pred             cceeeEEEEEee------cCCccCCCeE
Confidence            555555665443      4577777776


Done!