Query         013500
Match_columns 442
No_of_seqs    170 out of 388
Neff          3.0 
Searched_HMMs 46136
Date          Fri Mar 29 04:28:59 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/013500.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/013500hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF06203 CCT:  CCT motif;  Inte  99.7 5.5E-19 1.2E-23  132.2   2.7   45  380-424     1-45  (45)
  2 KOG1601 GATA-4/5/6 transcripti  96.4  0.0012 2.5E-08   58.4   1.1   41  377-417   290-330 (340)
  3 PF09425 CCT_2:  Divergent CCT   93.1   0.057 1.2E-06   37.5   1.6   24  379-403     3-26  (27)
  4 smart00521 CBF CCAAT-Binding t  24.0      78  0.0017   26.1   2.7   25  397-421    36-61  (62)
  5 PF02045 CBFB_NFYA:  CCAAT-bind  20.5      61  0.0013   26.4   1.5   22  398-419    36-58  (58)
  6 PF11302 DUF3104:  Protein of u  16.3      71  0.0015   27.1   1.0   26  247-272     4-37  (75)
  7 COG5614 Bacteriophage head-tai  11.4      56  0.0012   29.5  -1.0   62  336-421    24-85  (109)
  8 PF13653 GDPD_2:  Glycerophosph  11.3      96  0.0021   21.9   0.4   14  194-207    14-27  (30)
  9 KOG2422 Uncharacterized conser  11.1 1.3E+02  0.0029   34.1   1.5   11  294-304    94-104 (665)
 10 PF03286 Pox_Ag35:  Pox virus A  11.1   2E+02  0.0044   28.2   2.6    9  263-271    35-43  (200)

No 1  
>PF06203 CCT:  CCT motif;  InterPro: IPR010402 The CCT (CONSTANS, CO-like, and TOC1) domain is a highly conserved basic module of ~43 amino acids, which is found near the C terminus of plant proteins often involved in light signal transduction. The CCT domain is found in association with other domains, such as the B-box zinc finger, the GATA-type zinc finger, the ZIM motif or the response regulatory domain. The CCT domain contains a putative nuclear localisation signal within the second half of the CCT motif and has been shown to be involved in nuclear localization and probably also has a role in protein-protein interaction [].; GO: 0005515 protein binding
Probab=99.74  E-value=5.5e-19  Score=132.22  Aligned_cols=45  Identities=58%  Similarity=1.007  Sum_probs=43.2

Q ss_pred             HHHHHHHHHHHhhhccCCCcccchhhhcccccCCCcCcccccCCC
Q 013500          380 REASVLRYKEKRRTRLFSKKIRYQVRKVNADRRPRMKGRFVRRPN  424 (442)
Q Consensus       380 Rea~v~RYreKRk~R~f~KkIRY~~RK~~Ae~RPRvKGRFVk~~~  424 (442)
                      |+++|+||+|||++|+|+|+|+|+|||.+|+.|||||||||+.++
T Consensus         1 R~~~l~Ry~~Kr~~R~f~kkirY~~Rk~~A~~R~RvkGRFvk~~e   45 (45)
T PF06203_consen    1 REEKLQRYREKRKRRNFEKKIRYESRKAVADKRPRVKGRFVKKSE   45 (45)
T ss_pred             CHHHHHHHHHHHHhhcccccCCcchHHHHHhhCCccCCcccCCCC
Confidence            789999999999999999999999999999999999999999864


No 2  
>KOG1601 consensus GATA-4/5/6 transcription factors [Transcription]
Probab=96.43  E-value=0.0012  Score=58.38  Aligned_cols=41  Identities=54%  Similarity=0.821  Sum_probs=39.4

Q ss_pred             chhHHHHHHHHHHHhhhccCCCcccchhhhcccccCCCcCc
Q 013500          377 GGLREASVLRYKEKRRTRLFSKKIRYQVRKVNADRRPRMKG  417 (442)
Q Consensus       377 ~~~Rea~v~RYreKRk~R~f~KkIRY~~RK~~Ae~RPRvKG  417 (442)
                      ...|++.+.||++++..|.|.++++|..|+.+|+.|||+||
T Consensus       290 ~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  330 (340)
T KOG1601|consen  290 SHQRVAEVRRYRESRDGRYFDKGIRYASRKSNAESRPRLKG  330 (340)
T ss_pred             cchHHHHHhhccCccCCcccccccccccccccchhcccccc
Confidence            35899999999999999999999999999999999999999


No 3  
>PF09425 CCT_2:  Divergent CCT motif;  InterPro: IPR018467 The short CCT (CO, COL, TOC1) motif is found in a number of plant proteins, including Constans (CO), Constans-like (COL) and TOC1. The CCT motif is about 45 amino acids long and contains a putative nuclear localisation signal within the second half of the CCT motif []. The CCT motif is found in the Arabidopsis circadian rhythm protein TOC1, an autoregulatory response regulator homologue the controls the photoperiodic flowering through its clock function []. ; GO: 0005515 protein binding; PDB: 3OGK_V 3OGL_S 3OGM_W.
Probab=93.08  E-value=0.057  Score=37.55  Aligned_cols=24  Identities=50%  Similarity=0.693  Sum_probs=9.9

Q ss_pred             hHHHHHHHHHHHhhhccCCCcccch
Q 013500          379 LREASVLRYKEKRRTRLFSKKIRYQ  403 (442)
Q Consensus       379 ~Rea~v~RYreKRk~R~f~KkIRY~  403 (442)
                      .|.+.|+||.||||.|... +.-|.
T Consensus         3 aRK~SLqRFLeKRK~R~~~-~~PY~   26 (27)
T PF09425_consen    3 ARKASLQRFLEKRKDRLAA-KSPYQ   26 (27)
T ss_dssp             ---HHHHHHHHHH------------
T ss_pred             hHHHHHHHHHHHHHHhhcc-CCCCC
Confidence            5999999999999999987 66664


No 4  
>smart00521 CBF CCAAT-Binding transcription Factor.
Probab=23.96  E-value=78  Score=26.15  Aligned_cols=25  Identities=40%  Similarity=0.604  Sum_probs=21.7

Q ss_pred             CCcccchhhhcccccCCC-cCccccc
Q 013500          397 SKKIRYQVRKVNADRRPR-MKGRFVR  421 (442)
Q Consensus       397 ~KkIRY~~RK~~Ae~RPR-vKGRFVk  421 (442)
                      .|..-|++|-+.|-+||| --|||.+
T Consensus        36 rkpYlhESRH~HAm~R~Rg~gGRFl~   61 (62)
T smart00521       36 RKPYLHESRHLHAMRRPRGSGGRFLN   61 (62)
T ss_pred             cCCcccchhHHHHHccCcCCCCCCCC
Confidence            467889999999999999 5589975


No 5  
>PF02045 CBFB_NFYA:  CCAAT-binding transcription factor (CBF-B/NF-YA) subunit B;  InterPro: IPR001289 The CCAAT-binding factor (CBFB/NF-YA) is a mammalian transcription factor that binds to a CCAAT motif in the promoters of a wide variety of genes, including type I collagen and albumin []. The factor is a heteromeric complex of A and B subunits, both of which are required for DNA-binding []. The subunits can interact in the absence of DNA-binding, conserved regions in each being important in mediating this interaction. The B subunit contains a region of similarity with the yeast protein HAP2 []. For the B subunit it has been suggested that the N-terminal portion of the conserved region is involved in subunit interaction and the C-terminal region involved in DNA-binding [].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=20.49  E-value=61  Score=26.40  Aligned_cols=22  Identities=45%  Similarity=0.573  Sum_probs=18.5

Q ss_pred             CcccchhhhcccccCCCc-Cccc
Q 013500          398 KKIRYQVRKVNADRRPRM-KGRF  419 (442)
Q Consensus       398 KkIRY~~RK~~Ae~RPRv-KGRF  419 (442)
                      |+.-|++|-+.|-.|||- -|||
T Consensus        36 k~YlheSRH~HA~~R~Rg~gGRF   58 (58)
T PF02045_consen   36 KPYLHESRHKHAMRRPRGPGGRF   58 (58)
T ss_pred             HHHHHHHHHHHHHcCccCCCCCC
Confidence            556899999999999994 5777


No 6  
>PF11302 DUF3104:  Protein of unknown function (DUF3104);  InterPro: IPR021453  This family of proteins with unknown function appears to be restricted to Cyanobacteria. 
Probab=16.35  E-value=71  Score=27.14  Aligned_cols=26  Identities=15%  Similarity=0.516  Sum_probs=15.7

Q ss_pred             ccccccc-------ccccccCCCCcccccc-ccc
Q 013500          247 FGMRSGM-------KALRQVDEGNWWNFPI-DVL  272 (442)
Q Consensus       247 lg~r~~~-------~ALR~~dd~~wW~~p~-dv~  272 (442)
                      |+++.|+       +..-+..+.+|||-=+ .+.
T Consensus         4 L~Vk~Gd~ViV~~~~~~~~~~~~dWWmg~Vi~~~   37 (75)
T PF11302_consen    4 LSVKPGDTVIVQDEQEVGQKQDKDWWMGQVIHCE   37 (75)
T ss_pred             cccCCCCEEEEecCccccccCCCCcEEEEEEEEe
Confidence            4556663       2333455789999766 443


No 7  
>COG5614 Bacteriophage head-tail adaptor [General function prediction only]
Probab=11.41  E-value=56  Score=29.51  Aligned_cols=62  Identities=21%  Similarity=0.310  Sum_probs=37.0

Q ss_pred             hhhHhhhhCCCCCCCCCCCCCCCCCCCcccccccccccCCCchhHHHHHHHHHHHhhhccCCCcccchhhhcccccCCCc
Q 013500          336 YDDVLNAWSGKGSPFLDESLAPDGQGNDVSARLAQIDLFSDGGLREASVLRYKEKRRTRLFSKKIRYQVRKVNADRRPRM  415 (442)
Q Consensus       336 Ye~Vl~AWs~~GS~~~d~~~~Pdss~~~~~a~~~~i~lf~~~~~Rea~v~RYreKRk~R~f~KkIRY~~RK~~Ae~RPRv  415 (442)
                      |.+.+++|-+-+++|+.......   .+..+  .         .+|..      +.--|   =.|||. +-..|..|-++
T Consensus        24 ~g~~~e~w~d~~t~WAai~~~s~---kE~~a--A---------gaE~~------~~t~r---iwIRyr-~DItA~~Ri~~   79 (109)
T COG5614          24 AGEMTEEWVDCGTLWAAIRGRSG---KEFMA--A---------GAEMA------QATIR---IWIRYR-RDITAASRLHV   79 (109)
T ss_pred             cCchhHHHhhhccHhhhhcCcch---hHHHh--c---------chhhc------eeEEE---EEEEee-ecccceeEEEE
Confidence            56899999999999998763221   11100  0         00000      00011   248887 78889999888


Q ss_pred             Cccccc
Q 013500          416 KGRFVR  421 (442)
Q Consensus       416 KGRFVk  421 (442)
                      .+|-.-
T Consensus        80 ~~Riln   85 (109)
T COG5614          80 LSRILN   85 (109)
T ss_pred             cCeeEE
Confidence            887543


No 8  
>PF13653 GDPD_2:  Glycerophosphoryl diester phosphodiesterase family; PDB: 3RLG_A 2F9R_B 1XX1_A 3RLH_A.
Probab=11.29  E-value=96  Score=21.95  Aligned_cols=14  Identities=36%  Similarity=0.634  Sum_probs=9.8

Q ss_pred             chHHhhhhhhhccC
Q 013500          194 DEEFEEGIDSIMGN  207 (442)
Q Consensus       194 dee~eeGIDsIMG~  207 (442)
                      -+.++.|+|+||=.
T Consensus        14 ~~~l~~GVDgI~Td   27 (30)
T PF13653_consen   14 RELLDLGVDGIMTD   27 (30)
T ss_dssp             HHHHHHT-SEEEES
T ss_pred             HHHHHcCCCEeeCC
Confidence            46678899999943


No 9  
>KOG2422 consensus Uncharacterized conserved protein [Function unknown]
Probab=11.13  E-value=1.3e+02  Score=34.10  Aligned_cols=11  Identities=36%  Similarity=0.513  Sum_probs=4.2

Q ss_pred             hhhhhcccCCc
Q 013500          294 EKRKKKVGKEK  304 (442)
Q Consensus       294 kKKkkKkk~~k  304 (442)
                      ||||||||+.+
T Consensus        94 KK~krkkKk~~  104 (665)
T KOG2422|consen   94 KKKKRKKKKST  104 (665)
T ss_pred             hhhhhcccccc
Confidence            33333333333


No 10 
>PF03286 Pox_Ag35:  Pox virus Ag35 surface protein;  InterPro: IPR004966 The Pox virus Ag35 surface protein is an evelope protein known as protein H5.; GO: 0019031 viral envelope
Probab=11.12  E-value=2e+02  Score=28.19  Aligned_cols=9  Identities=44%  Similarity=0.383  Sum_probs=6.0

Q ss_pred             Ccccccccc
Q 013500          263 NWWNFPIDV  271 (442)
Q Consensus       263 ~wW~~p~dv  271 (442)
                      +==-||.|+
T Consensus        35 ~DdiFP~DI   43 (200)
T PF03286_consen   35 NDDIFPEDI   43 (200)
T ss_pred             ccccCcccc
Confidence            444688877


Done!