Citrus Sinensis ID: 013506

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-

MESKGRIMSEHNEKWKAEEAIGGNRAAVEALRELITFPLLYSSQAQKLGLKWPRGLLLYGPPGTGKTSLVRAVVRECGAHLTVISPHSVHKAHVGESEKALREAFSQASSHALSGKPSVVFIDEIDALCPRRDHRREQDVRIASQLFTLMDSNKPSKTSVPHVVVVASTNRVDAIDPALRRSGRFDAEVEVTVPTAEERFEILKLYTKKVPLDANVDLEAIATSCNGYVGADLEALCREATMSAVKRSSDANECAGVLSVTMEDWRHARSVVGPSITRGVTVEIPKVTWEDIGGLRDLKKKLQQAVEWPIKHSTAFSRLGISPVRGALLHGPPGCSKTTLAKAAAHAAEASFFSLSGAELYSMYVGESEALLRNTFQRARLAAPSIIFFDEADVVGAKRGGSSSTSITVGERLLSTLLTEMDGLEQAKVIIYPISFIFQLS

cccccccccccccccccccccccHHHHHHHHHHHHHHHcccHHHHHHcccccccEEEEEccccccHHHHHHHHHHHHccEEEEEcccccccccccHHHHHHHHHHHHHHHHccccccEEEEEcccccccccccccccccHHHHHHHHHHHccccccccccccEEEEEEccccccccHHHcccccccEEEEEccccHHHHHHHHHHHHccccccccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHccccccccccEEEcccccccccccHHHHHHHHHHHHHHccccHHHHHHcccccccEEEEEccccccHHHHHHHHHHHccccEEEEcccccccccccHHHHHHHHHHHHHHHcccEEEEEEccccccccccccccccccHHHHHHHHHHHHHHcccccccEEEEEEEEEccc

****GRI*SEHNEKWKAEEAIGGNRAAVEALRELITFPLLYSSQAQKLGLKWPRGLLLYGPPGTGKTSLVRAVVRECGAHLTVISPHSVHKAHVGESEKALREAFSQASSHALSGKPSVVFIDEIDALCPR********VRIASQLFTLMDSNKPSKTSVPHVVVVASTNRVDAIDPALRRSGRFDAEVEVTVPTAEERFEILKLYTKKVPLDANVDLEAIATSCNGYVGADLEALCREATMSA*******NECAGVLSVTMEDWRHARSVVGPSITRGVTVEIPKVTWEDIGGLRDLKKKLQQAVEWPIKHSTAFSRLGISPVRGALLHGPPGCSKTTLAKAAAHAAEASFFSLSGAELYSMYVGESEALLRNTFQRARLAAPSIIFFDEADVVG***********TVGERLLSTLLTEMDGLEQAKVIIYPISFIFQLS

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Cell division control protein 48 homolog B	Probably functions in cell division and growth processes. Interacts with certain SNAREs as part of specialized membrane fusion events where vesicles from the same organelle fuse (homotypic fusion).	probable	Q9ZPR1

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3HU3, chain A
Confidence level:very confident
Coverage over the Query: 17-282
View the alignment between query and template
View the model in PyMOL

Template: 2X8A, chain A
Confidence level:very confident
Coverage over the Query: 292-397,410-436
View the alignment between query and template
View the model in PyMOL