Citrus Sinensis ID: 013511


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-
MAYGGGVPAAMSGLASASASTIKQVKLERESELRIEVGEMPLRLRLLNGNAEIYGTELPPEIWLTFPPRLKFAVFTWYEATIEMDGTPETDYTADETPMVSYVNVNAVLEGRRNHAKASPSKDSDASQGPRVIVVGPTDSGKSTLSRMLLSWAAKLGWKPTFVDLDIGQGAITIPGCIAATPIELPIDPVEGIPLEMPLVYFFGHATPSNNVELYKVLVKELAQMLERQFNGNAESRAAGMVINTMGWIEGVGYELLLHAIDTFKANVVLVLGQEKLFSMLRDVLKNRPNVDVVKLQKSGGVVSRNSKVRQKARSYRIREYFYGLTNDLSPHANVANFSDFLVYRIGGGPQAPRSALPIGADPVANPLRIVPVNVDQELLHLVLAVSYAKDADQIISSNVAGFIFVTNVDTQRKTITYLAPSPGMLPSKYLIAGTLTWLET
cccccccccccccccccccccEEEEEEccccEEEEEEcccEEEEEEEEEEEEEEcCEcccccEEEEccccEEEEEEccccEEEEEccccEEEECcccccEEEEEHHHHHHHHHcccccccccccccccccEEEEEccccccHHHHHHHHHHHHHHcccccEEEEccccccccccccEEEEEECcccccccccccccccEEEECccccccccHHHHHHHHHHHHHHHHHHHccccccccccEEEEcccccccHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHcccccccEEEEEccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccEEEEEcccccccccccccccccccccCEEECccccccccccEEEEEcccccHHHcccccEEEEEEEEECccccEEEEEccccccccccEEEEEccccccc
*************************KLERESELRIEVGEMPLRLRLLNGNAEIYGTELPPEIWLTFPPRLKFAVFTWYEATIEMDGTPETDYTADETPMVSYVNVNAVLEGRRNH***********SQGPRVIVVGPTDSGKSTLSRMLLSWAAKLGWKPTFVDLDIGQGAITIPGCIAATPIELPIDPVEGIPLEMPLVYFFGHATPSNNVELYKVLVKELAQMLERQFNGNAESRAAGMVINTMGWIEGVGYELLLHAIDTFKANVVLVLGQEKLFSMLRDVLKNRPNVDVVKLQKSG*************RSYRIREYFYGLTNDLSPHANVANFSDFLVYRIGGGPQAPRSALPIGADPVANPLRIVPVNVDQELLHLVLAVSYAKDADQIISSNVAGFIFVTNVDTQRKTITYLAPSPGMLPSKYLIAGTLTWL**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAYGGGVPAAMSGLASASASTIKQVKLERESELRIEVGEMPLRLRLLNGNAEIYGTELPPEIWLTFPPRLKFAVFTWYEATIEMDGTPETDYTADETPMVSYVNVNAVLEGRRNHAKASPSKDSDASQGPRVIVVGPTDSGKSTLSRMLLSWAAKLGWKPTFVDLDIGQGAITIPGCIAATPIELPIDPVEGIPLEMPLVYFFGHATPSNNVELYKVLVKELAQMLERQFNGNAESRAAGMVINTMGWIEGVGYELLLHAIDTFKANVVLVLGQEKLFSMLRDVLKNRPNVDVVKLQKSGGVVSRNSKVRQKARSYRIREYFYGLTNDLSPHANVANFSDFLVYRIGGGPQAPRSALPIGADPVANPLRIVPVNVDQELLHLVLAVSYAKDADQIISSNVAGFIFVTNVDTQRKTITYLAPSPGMLPSKYLIAGTLTWLET

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein clp1 Required for endonucleolytic cleavage during polyadenylation-dependent pre-mRNA 3'-end formation.probableQ10299
Protein clp1 Required for endonucleolytic cleavage during polyadenylation-dependent pre-mRNA 3'-end formation.probableA2RAW3
Polyribonucleotide 5'-hydroxyl-kinase Clp1 Polynucleotide kinase that can phosphorylate the 5'-hydroxyl groups of double-stranded RNA (dsRNA), single-stranded RNA (ssRNA), double stranded DNA (dsDNA) and double-stranded DNA:RNA hybrids. dsRNA is phosphorylated more efficiently than dsDNA, and the RNA component of a DNA:RNA hybrid is phosphorylated more efficiently than the DNA component. Appears to have roles in both tRNA splicing and mRNA 3'-end formation. Component of the tRNA splicing endonuclease complex. Phosphorylates the 5'-terminus of the tRNA 3'-exon during tRNA splicing; this phosphorylation event is a prerequisite for the subsequent ligation of the two exon halves and the production of a mature tRNA. Component of the pre-mRNA cleavage complex II (CF-II), which seems to be required for mRNA 3'-end formation. Also phosphorylates the 5'-terminus of exogenously introduced short interfering RNAs (siRNAs), which is a necessary prerequisite for their incorporation into the RNA-induced silencing complex (RISC). However, endogenous siRNAs and microRNAs (miRNAs) that are produced by the cleavage of dsRNA precursors by DICER1 already contain a 5'-phosphate group, so this protein may be dispensible for normal RNA-mediated gene silencing.probableQ5PQL4

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2NPI, chain A
Confidence level:very confident
Coverage over the Query: 18-111,122-352,364-440
View the alignment between query and template
View the model in PyMOL