BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 013514
         (441 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1H3O|B Chain B, Crystal Structure Of The Human Taf4-Taf12
           (Tafii135-Tafii20) Complex
 pdb|1H3O|D Chain D, Crystal Structure Of The Human Taf4-Taf12
           (Tafii135-Tafii20) Complex
          Length = 76

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 22/39 (56%), Positives = 34/39 (87%)

Query: 401 ILTKRSIQELVNQIDPSERLDPDVEDILVDIAEDFVESV 439
           +LTK+ +Q+LV ++DP+E+LD DVE+ L+ IA+DF+ESV
Sbjct: 5   VLTKKKLQDLVREVDPNEQLDEDVEEXLLQIADDFIESV 43


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.312    0.130    0.388 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,269,541
Number of Sequences: 62578
Number of extensions: 219324
Number of successful extensions: 282
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 281
Number of HSP's gapped (non-prelim): 1
length of query: 441
length of database: 14,973,337
effective HSP length: 102
effective length of query: 339
effective length of database: 8,590,381
effective search space: 2912139159
effective search space used: 2912139159
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 53 (25.0 bits)