Citrus Sinensis ID: 013531


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-
MAASKLVIFSLFFALILTAADVSIQGEDVPPLTASDAVDSSPLKIELDQLKSKIRSLESHIDEKTQELKGKDEVVAQKEKAIQDKSERIVSLQKELSSLQKKETLNAAEQVDKAHARADELEKQIDNLKKESEKQQKEKEALEARAIEAEKKISDLSAKLEKLQKINDEQKSKIRKTERALKEEMMRAKFEATSRSKELTEVHSAWLPPWLAVHLLQCQSLIETHWNAHGKPAMDVAIQKALEKKAQAGKWVQPHVETIKAKWIPAVKEQWVVFTTNVEPHVQTLKTKTIEACEATKTAVTPHIIRVQEVVDPYFQEAKKFSKPYIDQVATVAKPHVDNVRVALKPYTKKVVRAYGKFLKSATTYHHQVQASVQEMLKKHELTSPLATKELEWFAASALLVLPVIILFRIGSAIFCKKARKPVRHSHHHSRRKAKRGHPDK
ccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcHHHHHHHHHccHHHHHHHHHHccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccc
****KLVIFSLFFALILTAADVSIQ********************************************************************************************************************************************************************************VHSAWLPPWLAVHLLQCQSLIETHWNAHGKPAMDVAIQKALEKKAQAGKWVQPHVETIKAKWIPAVKEQWVVFTTNVEPHVQTLKTKTIEACEATKTAVTPHIIRVQEVVDPYFQEAKKFSKPYIDQVATVAKPHVDNVRVALKPYTKKVVRAYGKFLKSATTYHHQVQASVQEMLKKHELTSPLATKELEWFAASALLVLPVIILFRIGSAIFCKK***********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAASKLVIFSLFFALILTAADVSIQGEDVPPLTASDAVDSSPLKIExxxxxxxxxxxxxxxxxxxxxLKGKDEVxxxxxxxxxxxxxxxxxxxxxxxxxxxxExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAKFEATSRSKELTEVHSAWLPPWLAVHLLQCQSLIETHWNAHGKPAMDVAIQKALEKKAQAGKWVQPHVETIKAKWIPAVKEQWVVFTTNVEPHVQTLKTKTIEACEATKTAVTPHIIRVQEVVDPYFQEAKKFSKPYIDQVATVAKPHVDNVRVALKPYTKKVVRAYGKFLKSATTYHHQVQASVQEMLKKHELTSPLATKELEWFAASALLVLPVIILFRIGSAIFCKKARKPVRHSHHHSRRKAKRGHPDK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfer were detected in SWISS-PROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2DFS, chain A
Confidence level:very confident
Coverage over the Query: 76-182
View the alignment between query and template
View the model in PyMOL
Template: 2A01, chain A
Confidence level:confident
Coverage over the Query: 254-363
View the alignment between query and template
View the model in PyMOL
Template: 2LEM, chain A
Confidence level:probable
Coverage over the Query: 274-387
View the alignment between query and template
View the model in PyMOL
Template: 2XS1, chain A
Confidence level:probable
Coverage over the Query: 29-183
View the alignment between query and template
View the model in PyMOL
Template: 2ZUO, chain A
Confidence level:probable
Coverage over the Query: 54-202
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
3vkg, chain A confident Alignment | Template Structure