Citrus Sinensis ID: 013566


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440
MEEAEEEEVLGSKLTMEKVAAAKQFIENHYRAQMKNIQERKERRWVLERKLASSDVPMEEQINLIKDLERKETEFMRLKRHKICVDDFELLTIIGRGAFGEVRLCREKKSGNIYAMKKLKKSEMVKRGQVEHVRAERNLLAEVASHCIVKLYYSFQDTEYLYLIMEYLPGGDMMTLLMREDTLTENVARFYIAQSVLAIESIHKHNYIHRDIKPDNLLLDKNGHMKLSDFGLCKPLDCSTLYAIHEHKTIDDENMAEPMDIDGCFPDTDNKSSWKSPHEQLQHWQMNRRKLAFSTVGTPDYIAPEVLLKKGYGMECDWWSLGAIMYEMLVGYPPFYADDPITTCRKIVHWRNHLKFPDDSKLSPEAKDLICRLLCDVEHRLGTGGAHQIKAHPWFKDVVWDKLYEMEAAFKPEINGELDTQNFMKFDEVIFLHFHYSCCV
cccHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEcccccEEEEEEEEEccccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHccccEEcEEEEEEcccEEEEEEcccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHccccccccccccEEEcccccEEEcccccccccccccccHHcccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccHHHHccccccccccHHHHHHHHHHHHccccccccccHHHHHHHHHcccccccccccccccHHHHHHHHHHcccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccc
********************AAKQFIENHYRAQ**********RWVLE*************INLIKDLERKETEFMRLKRHKICVDDFELLTIIGRGAFGEVRLCREKKSGNIYAMKKLKKSEMVKRGQVEHVRAERNLLAEVASHCIVKLYYSFQDTEYLYLIMEYLPGGDMMTLLMREDTLTENVARFYIAQSVLAIESIHKHNYIHRDIKPDNLLLDKNGHMKLSDFGLCKPLDCSTLY****************************************HWQMNRRKLAFSTVGTPDYIAPEVLLKKGYGMECDWWSLGAIMYEMLVGYPPFYADDPITTCRKIVHWRNHLKFPDDSKLSPEAKDLICRLLCDVEHRLGTGGAHQIKAHPWFKDVVWDKLYEMEAAFKPEINGELDTQNFMKFDEVIFL********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEEAEEEEVLGSKLTMEKVAAAKQFIENHYRAQMKNIQERKERRWVLERKLASSDVPMEEQINLIKDLERKETEFMRLKRHKICVDDFELLTIIGRGAFGEVRLCREKKSGNIYAMKKLKKSEMVKRGQVEHVRAERNLLAEVASHCIVKLYYSFQDTEYLYLIMEYLPGGDMMTLLMREDTLTENVARFYIAQSVLAIESIHKHNYIHRDIKPDNLLLDKNGHMKLSDFGLCKPLDCSTLYAIHEHKTIDDENMAEPMDIDGCFPDTDNKSSWKSPHEQLQHWQMNRRKLAFSTVGTPDYIAPEVLLKKGYGMECDWWSLGAIMYEMLVGYPPFYADDPITTCRKIVHWRNHLKFPDDSKLSPEAKDLICRLLCDVEHRLGTGGAHQIKAHPWFKDVVWDKLYEMEAAFKPEINGELDTQNFMKFDEVIFLHFHYSCCV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine/threonine-protein kinase 38-like Involved in the regulation of structural processes in differentiating and mature neuronal cells.probableQ9Y2H1
Serine/threonine-protein kinase tricorner Has an important role, with fry, in controlling cell structure and proliferation of a variety of polarized outgrowths including epidermal hairs, bristles, arista laterals, and dendrites. Affects cellular morphogenesis by regulating the expression of target genes that encode cytoskeleton-interacting proteins and not via the direct modification of the cytoskeleton. Maintains the integrity of epidermal hairs and is an essential component of the signaling pathway regulating dendritic branching of sensory neurons.probableQ9NBK5
Serine/threonine-protein kinase 38-like Involved in the regulation of structural processes in differentiating and mature neuronal cells.probableQ7TSE6

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.11.-Protein-serine/threonine kinases.probable
2.7.11.1Transferred entry: 2.7.11.19.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1RDQ, chain E
Confidence level:very confident
Coverage over the Query: 81-239,292-430
View the alignment between query and template
View the model in PyMOL
Template: 3RP9, chain A
Confidence level:very confident
Coverage over the Query: 84-246,260,297-404
View the alignment between query and template
View the model in PyMOL
Template: 2F2U, chain A
Confidence level:very confident
Coverage over the Query: 55-245,264-268,295-423
View the alignment between query and template
View the model in PyMOL
Template: 2HK5, chain A
Confidence level:probable
Coverage over the Query: 94-314
View the alignment between query and template
View the model in PyMOL