BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 013575
         (440 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2HPA|A Chain A, Structural Origins Of L(+)-Tartrate Inhibition Of Human
           Prostatic Acid Phosphatase
 pdb|2HPA|B Chain B, Structural Origins Of L(+)-Tartrate Inhibition Of Human
           Prostatic Acid Phosphatase
 pdb|2HPA|C Chain C, Structural Origins Of L(+)-Tartrate Inhibition Of Human
           Prostatic Acid Phosphatase
 pdb|2HPA|D Chain D, Structural Origins Of L(+)-Tartrate Inhibition Of Human
           Prostatic Acid Phosphatase
 pdb|1CVI|A Chain A, Crystal Structure Of Human Prostatic Acid Phosphatase
 pdb|1CVI|B Chain B, Crystal Structure Of Human Prostatic Acid Phosphatase
 pdb|1CVI|C Chain C, Crystal Structure Of Human Prostatic Acid Phosphatase
 pdb|1CVI|D Chain D, Crystal Structure Of Human Prostatic Acid Phosphatase
          Length = 342

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 36/72 (50%), Gaps = 12/72 (16%)

Query: 169 AQLQELQKE--KSD----RLHKVLEFVSTVHDLCGVLGMDFFSTVTEVHPSLNDSTGVQS 222
            + QEL+ E  KS+    RLH   +F++T+  L G+ G D F   ++V+  L        
Sbjct: 130 PRFQELESETLKSEEFQKRLHPYKDFIATLGKLSGLHGQDLFGIWSKVYDPL------YC 183

Query: 223 KSISNDTLARLA 234
           +S+ N TL   A
Sbjct: 184 ESVHNFTLPSWA 195


>pdb|1ND5|A Chain A, Crystal Structures Of Human Prostatic Acid Phosphatase In
           Complex With A Phosphate Ion And
           Alpha-Benzylaminobenzylphosphonic Acid Update The
           Mechanistic Picture And Offer New Insights Into
           Inhibitor Design
 pdb|1ND5|B Chain B, Crystal Structures Of Human Prostatic Acid Phosphatase In
           Complex With A Phosphate Ion And
           Alpha-Benzylaminobenzylphosphonic Acid Update The
           Mechanistic Picture And Offer New Insights Into
           Inhibitor Design
 pdb|1ND5|C Chain C, Crystal Structures Of Human Prostatic Acid Phosphatase In
           Complex With A Phosphate Ion And
           Alpha-Benzylaminobenzylphosphonic Acid Update The
           Mechanistic Picture And Offer New Insights Into
           Inhibitor Design
 pdb|1ND5|D Chain D, Crystal Structures Of Human Prostatic Acid Phosphatase In
           Complex With A Phosphate Ion And
           Alpha-Benzylaminobenzylphosphonic Acid Update The
           Mechanistic Picture And Offer New Insights Into
           Inhibitor Design
 pdb|1ND6|A Chain A, Crystal Structures Of Human Prostatic Acid Phosphatase In
           Complex With A Phosphate Ion And
           Alpha-Benzylaminobenzylphosphonic Acid Update The
           Mechanistic Picture And Offer New Insights Into
           Inhibitor Design
 pdb|1ND6|B Chain B, Crystal Structures Of Human Prostatic Acid Phosphatase In
           Complex With A Phosphate Ion And
           Alpha-Benzylaminobenzylphosphonic Acid Update The
           Mechanistic Picture And Offer New Insights Into
           Inhibitor Design
 pdb|1ND6|C Chain C, Crystal Structures Of Human Prostatic Acid Phosphatase In
           Complex With A Phosphate Ion And
           Alpha-Benzylaminobenzylphosphonic Acid Update The
           Mechanistic Picture And Offer New Insights Into
           Inhibitor Design
 pdb|1ND6|D Chain D, Crystal Structures Of Human Prostatic Acid Phosphatase In
           Complex With A Phosphate Ion And
           Alpha-Benzylaminobenzylphosphonic Acid Update The
           Mechanistic Picture And Offer New Insights Into
           Inhibitor Design
          Length = 354

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 36/72 (50%), Gaps = 12/72 (16%)

Query: 169 AQLQELQKE--KSD----RLHKVLEFVSTVHDLCGVLGMDFFSTVTEVHPSLNDSTGVQS 222
            + QEL+ E  KS+    RLH   +F++T+  L G+ G D F   ++V+  L        
Sbjct: 130 PRFQELESETLKSEEFQKRLHPYKDFIATLGKLSGLHGQDLFGIWSKVYDPL------YC 183

Query: 223 KSISNDTLARLA 234
           +S+ N TL   A
Sbjct: 184 ESVHNFTLPSWA 195


>pdb|3CUQ|A Chain A, Integrated Structural And Functional Model Of The Human
           Escrt-Ii Complex
          Length = 234

 Score = 28.9 bits (63), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 12/41 (29%), Positives = 21/41 (51%)

Query: 162 KKLDEYQAQLQELQKEKSDRLHKVLEFVSTVHDLCGVLGMD 202
           K+LD ++  L+E   +    + K  EF     D+C  +G+D
Sbjct: 14  KQLDMFKTNLEEFASKHKQEIRKNPEFRVQFQDMCATIGVD 54


>pdb|2ZME|A Chain A, Integrated Structural And Functional Model Of The Human
           Escrt-Ii Complex
          Length = 258

 Score = 28.9 bits (63), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 12/41 (29%), Positives = 21/41 (51%)

Query: 162 KKLDEYQAQLQELQKEKSDRLHKVLEFVSTVHDLCGVLGMD 202
           K+LD ++  L+E   +    + K  EF     D+C  +G+D
Sbjct: 38  KQLDMFKTNLEEFASKHKQEIRKNPEFRVQFQDMCATIGVD 78


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.314    0.130    0.363 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 11,760,520
Number of Sequences: 62578
Number of extensions: 447907
Number of successful extensions: 1285
Number of sequences better than 100.0: 14
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 11
Number of HSP's that attempted gapping in prelim test: 1279
Number of HSP's gapped (non-prelim): 17
length of query: 440
length of database: 14,973,337
effective HSP length: 102
effective length of query: 338
effective length of database: 8,590,381
effective search space: 2903548778
effective search space used: 2903548778
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 53 (25.0 bits)