BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 013580
(440 letters)
Database: swissprot
539,616 sequences; 191,569,459 total letters
Searching..................................................done
>sp|P34268|FLII_CAEEL Protein flightless-1 homolog OS=Caenorhabditis elegans GN=fli-1
PE=2 SV=2
Length = 1257
Score = 35.4 bits (80), Expect = 0.81, Method: Compositional matrix adjust.
Identities = 19/48 (39%), Positives = 30/48 (62%), Gaps = 1/48 (2%)
Query: 131 ARFEG-SHWVPIGWARISELVQTVQQLELIDDEDDITVADLAAPYWER 177
++F G VP+ + R S+ VQ V L++I +D++ ADLAA + ER
Sbjct: 833 SKFAGWDEIVPVDYTRTSDSVQRVPDLKVIVKKDNMMRADLAALFLER 880
Database: swissprot
Posted date: Mar 23, 2013 2:32 AM
Number of letters in database: 191,569,459
Number of sequences in database: 539,616
Lambda K H
0.319 0.134 0.402
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 163,755,168
Number of Sequences: 539616
Number of extensions: 6779132
Number of successful extensions: 17612
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 17609
Number of HSP's gapped (non-prelim): 8
length of query: 440
length of database: 191,569,459
effective HSP length: 121
effective length of query: 319
effective length of database: 126,275,923
effective search space: 40282019437
effective search space used: 40282019437
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 63 (28.9 bits)