Citrus Sinensis ID: 013616

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------44

MLIDGPKQGNVIPDGFNPNYLKVYYGRLFPHADIFKWMSYGNDGRHPACDKSYFGRREFSFTLDNDIYLRFQSFNSESELENSIKEKCPSKIDIGPVYSVDPAKRHAYAQGGDNVFAPVERELIFDIDITDYDDVRYCCSGADVCLECWPLMTVAIKVIDTALRDDFGFDHILWVYSGRRGVHCWVCDGKARRLTNEQRGAIADYFRVYKGNENSNKKVSFPGPLHPFLVRSYTEVLREFFEEKLLLSQNLFSTEERYEKILSMIPDESVTSELRGKWQENRRSSNSKEDINFFRWEQLKNTLQSGKQKVQGLRRCVEEIVFAFTYPRLDMEVSKHRNHLLKAPFCVHPKTGRVCIPIDPKDCEEFDPTTVPTLSELLRELNTGDSRMDVDNEWEKTSLGKSIRFFRSSFLQPLLKSCKEEMESGYKAKIQQTKNSLSW

cccccccccccccccccHHHHHHHHHHHccHHHHHHHHccccccccccccccccccccEEEEEcccEEEEEcccccHHHHHHHHHHHccccEEEccccccccHHHHHccccccccccccccHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEECccccEEEEECcHHHccccHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccEEEEEccccccccccccccccHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc

*************DGFNPNYLKVYYGRLFPHADIFKWMSYGNDGRHPACDKSYFGRREFSFTLDNDIYLRFQSFNSESELENSIKEKCPSKIDIGPVYSVDPAKRHAYAQGGDNVFAPVERELIFDIDITDYDDVRYCCSGADVCLECWPLMTVAIKVIDTALRDDFGFDHILWVYSGRRGVHCWVCDGKARRLTNEQRGAIADYFRVYKGNENSNKKVSFPGPLHPFLVRSYTEVLREFFEEKLLLSQNLFSTEERYEKILSMIPDESVT*******************INFFRWEQLKNTLQSGKQKVQGLRRCVEEIVFAFTYPRLDMEVSKHRNHLLKAPFCVHPKTGRVCIPIDPKDCEEFDPTTVPTLSELLRELNT**********WEKTSLGKSIRFFRSSFLQPLL************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
DNA primase small subunit	DNA primase is the polymerase that synthesizes small RNA primers for the Okazaki fragments made during discontinuous DNA replication.	probable	Q24317
DNA primase small subunit	DNA primase is the polymerase that synthesizes small RNA primers for the Okazaki fragments made during discontinuous DNA replication.	probable	P49642
DNA primase small subunit	DNA primase is the polymerase that synthesizes small RNA primers for the Okazaki fragments made during discontinuous DNA replication.	probable	Q7KQM1

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1V33, chain A
Confidence level:very confident
Coverage over the Query: 11-40,53-276,289-376
View the alignment between query and template
View the model in PyMOL