BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 013621
         (439 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|P34268|FLII_CAEEL Protein flightless-1 homolog OS=Caenorhabditis elegans GN=fli-1
           PE=2 SV=2
          Length = 1257

 Score = 35.4 bits (80), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 30/48 (62%), Gaps = 1/48 (2%)

Query: 131 ARFEG-SHWVPIGWARISELVQTVQQLELIDDEDDITVADLAAPYWER 177
           ++F G    VP+ + R S+ VQ V  L++I  +D++  ADLAA + ER
Sbjct: 833 SKFAGWDEIVPVDYTRTSDSVQRVPDLKVIVKKDNMMRADLAALFLER 880


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.319    0.134    0.404 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 162,377,402
Number of Sequences: 539616
Number of extensions: 6722713
Number of successful extensions: 17447
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 17445
Number of HSP's gapped (non-prelim): 6
length of query: 439
length of database: 191,569,459
effective HSP length: 121
effective length of query: 318
effective length of database: 126,275,923
effective search space: 40155743514
effective search space used: 40155743514
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 63 (28.9 bits)