BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 013624
(439 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1OJ7|A Chain A, Structural Genomics, Unknown Function Crystal Structure
Of E. Coli K-12 Yqhd
pdb|1OJ7|B Chain B, Structural Genomics, Unknown Function Crystal Structure
Of E. Coli K-12 Yqhd
pdb|1OJ7|C Chain C, Structural Genomics, Unknown Function Crystal Structure
Of E. Coli K-12 Yqhd
pdb|1OJ7|D Chain D, Structural Genomics, Unknown Function Crystal Structure
Of E. Coli K-12 Yqhd
Length = 408
Score = 28.9 bits (63), Expect = 6.7, Method: Compositional matrix adjust.
Identities = 14/40 (35%), Positives = 22/40 (55%)
Query: 14 LFVSGRPEQPKEKAPTMSSVAMPYTGGDIKKSGELGKMFD 53
LF G +E+ P + V + Y GG +KK+G L ++ D
Sbjct: 34 LFGKGAIAGLREQIPHDARVLITYGGGSVKKTGVLDQVLD 73
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.315 0.134 0.402
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 13,118,610
Number of Sequences: 62578
Number of extensions: 544695
Number of successful extensions: 1096
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1095
Number of HSP's gapped (non-prelim): 1
length of query: 439
length of database: 14,973,337
effective HSP length: 102
effective length of query: 337
effective length of database: 8,590,381
effective search space: 2894958397
effective search space used: 2894958397
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 53 (25.0 bits)