BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 013668
         (438 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3MKB|B Chain B, Crystal Structure Determination Of Shortfin Mako (Isurus
           Oxyrinchus) Hemoglobin At 1.9 Angstrom Resolution
 pdb|3MKB|D Chain D, Crystal Structure Determination Of Shortfin Mako (Isurus
           Oxyrinchus) Hemoglobin At 1.9 Angstrom Resolution
          Length = 136

 Score = 30.0 bits (66), Expect = 2.9,   Method: Composition-based stats.
 Identities = 13/41 (31%), Positives = 18/41 (43%)

Query: 224 QWQAGSRQQSVPSGFEPDKSSWGWNWLERWMAVRPWENRFL 264
            W    R + V + F  + S+ G   LER   V PW N + 
Sbjct: 2   HWTQEERDEIVKTFFSANSSAIGTKALERMFVVFPWTNAYF 42


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.308    0.122    0.356 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9,849,548
Number of Sequences: 62578
Number of extensions: 322114
Number of successful extensions: 588
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 586
Number of HSP's gapped (non-prelim): 2
length of query: 438
length of database: 14,973,337
effective HSP length: 102
effective length of query: 336
effective length of database: 8,590,381
effective search space: 2886368016
effective search space used: 2886368016
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 53 (25.0 bits)