BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 013685
(438 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1DYS|A Chain A, Endoglucanase Cel6b From Humicola Insolens
pdb|1DYS|B Chain B, Endoglucanase Cel6b From Humicola Insolens
Length = 348
Score = 28.5 bits (62), Expect = 8.6, Method: Compositional matrix adjust.
Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 1/40 (2%)
Query: 371 AAEAAASMLSTGNNGKCMERSGSIDSNYNPITGKIPLPYS 410
A E A + GNN K S ++ SNYNP + P PY+
Sbjct: 197 AQEVATILQKAGNNAKIRGFSSNV-SNYNPYSTSNPPPYT 235
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.305 0.120 0.305
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,986,847
Number of Sequences: 62578
Number of extensions: 291009
Number of successful extensions: 721
Number of sequences better than 100.0: 46
Number of HSP's better than 100.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 35
Number of HSP's that attempted gapping in prelim test: 679
Number of HSP's gapped (non-prelim): 71
length of query: 438
length of database: 14,973,337
effective HSP length: 102
effective length of query: 336
effective length of database: 8,590,381
effective search space: 2886368016
effective search space used: 2886368016
T: 11
A: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (22.0 bits)
S2: 53 (25.0 bits)