BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 013699
(438 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3MKB|B Chain B, Crystal Structure Determination Of Shortfin Mako (Isurus
Oxyrinchus) Hemoglobin At 1.9 Angstrom Resolution
pdb|3MKB|D Chain D, Crystal Structure Determination Of Shortfin Mako (Isurus
Oxyrinchus) Hemoglobin At 1.9 Angstrom Resolution
Length = 136
Score = 30.0 bits (66), Expect = 2.9, Method: Composition-based stats.
Identities = 13/41 (31%), Positives = 18/41 (43%)
Query: 224 QWQAGSRQQSVPSGFEPDKSSWGWNWLERWMAVRPWENRFL 264
W R + V + F + S+ G LER V PW N +
Sbjct: 2 HWTQEERDEIVKTFFSANSSAIGTKALERMFVVFPWTNAYF 42
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.308 0.122 0.356
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9,849,548
Number of Sequences: 62578
Number of extensions: 322114
Number of successful extensions: 588
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 586
Number of HSP's gapped (non-prelim): 2
length of query: 438
length of database: 14,973,337
effective HSP length: 102
effective length of query: 336
effective length of database: 8,590,381
effective search space: 2886368016
effective search space used: 2886368016
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 53 (25.0 bits)