Citrus Sinensis ID: 013708

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------44

MEKAINRQQVLLEHLRPSNSSSHNYESILSASACAAGDSAAYHRTSVYGDDVVIVAAYRTALCKSKRGGFKDTYPDDLLAPVLKAVIEKTNVDPSEVGDIVVETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVNPMAWEGSVNPKVKAFEQAQNCLLPMGVTSENVAHRFGVTRKEQDQAAVDSHRKAAAATAAGKFKDEIIPVATKIVDPKTGDEKPVTISVDDGIRPNTSVSELAKLKPVFKKDGTTTAGNSSQVSDGAGAVLLMKRSVAMRKGLPILGVFRTFAAVGVDPAIMGVGPAVAIPAAVKSAGLQLDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGALAIGHPLGTTGARCVATLLHEMKRRGRDCRFGVISMCIGTGMGAAAVFERGDCADELCNVRKVESNNFLSKDVL

cHHHHHHHHHHHHcccccccccccccHHHHHHHHcccccHHHcccccccccEEEEcccccccccccccccccccHHcHHHHHHHHHHHHccccccccccEEEcccccccccccccHHHHHHHHHHHHHHcccccEEEEEccccccccccccccccccHHHHHHccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEECcccccccccEEECccccccccccHHHHccccccccccccccccccccccHHHHHHHHccHHHHHHccccccEEEEEEEEccccccccccccccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHccccccccccccHHccccccccHHHHHHHHHHHHHHHccccccEEEEEEcccccccEEEEEEEcccccccccccccccccccccccc

*****NR***L*******************************H**SVYGDDVVIVAAYRTALCKSKRGGFKDTYPDDLLAPVLKAVIEKTNVDPSEVGDIVVETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVNPMAWEGSVNPKVKAFEQAQNCLLPMGVTSENVAHRFGVTRKEQDQAAVDSHRKAAAATAAGKFKDEIIPVATKIVDPKTGDEKPVTISVDDGIRPNTSVSELAKLKPVFKKDGTTTAGNSSQVSDGAGAVLLMKRSVAMRKGLPILGVFRTFAAVGVDPAIMGVGPAVAIPAAVKSAGLQLDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGALAIGHPLGTTGARCVATLLHEMKRRGRDCRFGVISMCIGTGMGAAAVFERGDCADELCNVRKVES*N*LS****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
3-ketoacyl-CoA thiolase 2, peroxisomal	Involved in long chain fatty-acid beta-oxidation prior to gluconeogenesis during germination and subsequent seedling growth. Confers sensitivity to 2,4-dichlorophenoxybutiric acid (2,4-DB). Required for local and systemic induction of jasmonic acid (JA) biosynthesis after wounding. Seems to be involved in JA biosynthesis during senescence.	confident	Q56WD9
3-ketoacyl-CoA thiolase, peroxisomal		probable	P09110
3-ketoacyl-CoA thiolase B, peroxisomal		probable	Q8VCH0

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
2.-.-.-	Transferases.	probable
2.3.-.-	Acyltransferases.	probable
2.3.1.-	Transferring groups other than amino-acyl groups.	probable
2.3.1.16	Acetyl-CoA C-acyltransferase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2WU9, chain A
Confidence level:very confident
Coverage over the Query: 46-424
View the alignment between query and template
View the model in PyMOL