Citrus Sinensis ID: 013725

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------

MSDGQETDKNIEIWKIKKLIKALESARGNGTSMISLIMPPRDQISRVTKMLGDEFGTASNIKSRVNRQSVLAAITSAQQRLKLYNKVPPNGLVLYTGTVVTDDGKEKKVTIDFEPFKPINASLYLCDNKFHTEALNELLESDDKFGFIVMDGNGTLFGTLSGNTREVLHKFTVDLPKKHGRGGQSALRFARLRMEKRHNYVRKTAELATQFFINPATSQPNVSGLILAGSADFKTELSQSDMFDPRLQAKILNVVDVSYGGENGFNQAIELSAEILSNVKFIQEKRLIGKYFEEISQDTGKYVFGVDDTLKALELGAVEILIVWENLDINRYVLKNSATGEIVIKHLNRDQEADQSNFRDAATSAELEVQEKTSLLEWFANEYKQFGCTLEFVTNKSQEGSQFCRGFGGIGGILRYQLDIRSYDELSDDGGVYEDSD

cccccccccHHHHHHHHHHHHHHHcccccccEEEEEEccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHcccccccCEEEEEEEEEcccccEEEEEEEcccccccccccccccccccHHHHHHHHHccccEEEEEECcccEEEEEEEccEEEEEEEEEECcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEccccHHHHHHHccccccHHHHccccEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEcHHHHHHHHHcccccEEEEEccccccEEEEEccccccEEEEEEcccccccccccccccccccHHHHHHccHHHHHHHHHHHcccEEEEEccccccHHHHHHccccEEEEEEEccccccccccccccccccccc

**********IEIWKIKKLIKALESARGNGTSMISLIMPPRDQISRVTKMLGDEFGTA*NIKSRVNRQSVLAAITSAQQRLKLYNKVPPNGLVLYTGTVVTDDGKEKKVTIDFEPFKPINASLYLCDNKFHTEALNELLESDDKFGFIVMDGNGTLFGTLSGNTREVLHKFTVDLPKKH****QSALRFARLRMEKRHNYVRKTAELATQFFINPATSQPNVSGLILAGSADFKTELSQSDMFDPRLQAKILNVVDVSYGGENGFNQAIELSAEILSNVKFIQEKRLIGKYFEEISQDTGKYVFGVDDTLKALELGAVEILIVWENLDINRYVLKNSATGEIVIKHLNRD********RDAATSAELEVQEKTSLLEWFANEYKQFGCTLEFVTNKSQEGSQFCRGFGGIGGILRYQLDIRSYDE*SD*********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Eukaryotic peptide chain release factor subunit 1-3	Directs the termination of nascent peptide synthesis (translation) in response to the termination codons UAA, UAG and UGA.	confident	P35614
Eukaryotic peptide chain release factor subunit 1	Directs the termination of nascent peptide synthesis (translation) in response to the termination codons UAA, UAG and UGA (By similarity). Component of the transient SURF complex which recruits UPF1 to stalled ribosomes in the context of nonsense-mediated decay (NMD) of mRNAs containing premature stop codons.	confident	Q8BWY3
Eukaryotic peptide chain release factor subunit 1	Directs the termination of nascent peptide synthesis (translation) in response to the termination codons UAA, UAG and UGA. Component of the transient SURF complex which recruits UPF1 to stalled ribosomes in the context of nonsense-mediated decay (NMD) of mRNAs containing premature stop codons.	confident	Q5U2Q7

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1DT9, chain A
Confidence level:very confident
Coverage over the Query: 4-359,371-423
View the alignment between query and template
View the model in PyMOL