Citrus Sinensis ID: 013727

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------
MAEEKEVKTFKELGLRDELVEACENVGWKTPSKIQAEAIPHALEGKDLIGLAQTGSGKTGAFALPILQALLEIAENQRTVPAFFACVLSPTRELAIQISEQFEALGSGISLRCAVLVGGVDMMQQTLALGKRPHIVVATPGRLMDHLTNTKGFSLGTLKYLVLDEADRLLNDDFEKSLDEILNVIPRMRQTYLFSATMTKKVKKLQRACLKNPVKIEAASKYSTVDTLKQQYRFVPAKYKDCYLVYILTEVSASSTMVFTRTCDATRLLALMLRNLGQRAIPISGHMSQSKRLGALNKFKAGECNILICTDVASRGLDIPSVDMVINYDIPTNSKDYIHRVGRTARAGRTGVAISLVNQYELEWYLQIEKLIGKKLPEFPAEEEEVLLLLERVTEAKRISQMTIKDSGNKRRRKGGDEDDDIGRQFGINKKKLSKRK
ccccccccccccccccHHHHHHHHHcccccccHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHHHHHHHccccccccEEEEEEcccHHHHHHHHHHHHHHcccccccEEEEEccccHHHHHHHHcccccEEEEcccHHHHHHccccccccccccEEEEEccccccccccHHHHHHHHHHcccccccEEEEccccHHHHHHHHHHccccEEEEEccccccccccEEEEEEcccccHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHcccccEEEEEcccccccccccccEEEEcccccccccccccccccccccccccEEEEEcHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccc
*********FKELGLRDELVEACENVGWKTPSKIQAEAIPHALEGKDLIGLAQTGSGKTGAFALPILQALLEIAENQRTVPAFFACVLSPTRELAIQISEQFEALGSGISLRCAVLVGGVDMMQQTLALGKRPHIVVATPGRLMDHLTNTKGFSLGTLKYLVLDEADRLLNDDFEKSLDEILNVIPRMRQTYLFSATMTKKVKKLQRACLKNPVKIEAASKYSTVDTLKQQYRFVPAKYKDCYLVYILTEVSASSTMVFTRTCDATRLLALMLRNLGQRAIPISGHMSQSKRLGALNKFKAGECNILICTDVASRGLDIPSVDMVINYDIPTNSKDYIHRVGRTARAGRTGVAISLVNQYELEWYLQIEKLIGKKLPEFPAEEEE****************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEEKEVKTFKELGLRDELVEACENVGWKTPSKIQAEAIPHALEGKDLIGLAQTGSGKTGAFALPILQALLEIAENQRTVPAFFACVLSPTRELAIQISEQFEALGSGISLRCAVLVGGVDMMQQTLALGKRPHIVVATPGRLMDHLTNTKGFSLGTLKYLVLDEADRLLNDDFEKSLDEILNVIPRMRQTYLFSATMTKKVKKLQRACLKNPVKIEAASKYSTVDTLKQQYRFVPAKYKDCYLVYILTEVSASSTMVFTRTCDATRLLALMLRNLGQRAIPISGHMSQSKRLGALNKFKAGECNILICTDVASRGLDIPSVDMVINYDIPTNSKDYIHRVGRTARAGRTGVAISLVNQYELEWYLQIEKLIGKKLPEFPAEEEEVLLLLERVTEAKRISQMTIKDSGNKRRRKGGDEDDDIGRQFGINKKKLSKRK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DEAD-box ATP-dependent RNA helicase 10 confidentQ8GY84
DEAD-box ATP-dependent RNA helicase 10 probableQ7Y183
ATP-dependent rRNA helicase RRP3 Required for pre-ribosomal RNA processing. Involved in the maturation of the 35S-pre-rRNA and to its cleavage to mature 18S rRNA.probableA3LS22

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.6.-.-Acting on acid anhydrides.probable
3.6.4.-Acting on acid anhydrides; involved in cellular and subcellular movement.probable
3.6.4.13RNA helicase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BER, chain A
Confidence level:very confident
Coverage over the Query: 4-218
View the alignment between query and template
View the model in PyMOL
Template: 1WP9, chain A
Confidence level:very confident
Coverage over the Query: 30-363
View the alignment between query and template
View the model in PyMOL
Template: 2I4I, chain A
Confidence level:very confident
Coverage over the Query: 3-380
View the alignment between query and template
View the model in PyMOL