Citrus Sinensis ID: 013733


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------
MRNYKPQYEKVARLFNGPNAAHPGIILMTRVDCALKINTNLCDKFSVGHYPMLLWGSPSKFVAGSWEPNQEKKEIRALEDWQTADGLLTWINKQTSRSYGLDDEKFENEQLPSNISDPGQIARAVYDVEEATTTAFDIILDHKMIKSETRASLIRFLQVLVAHHPSRRCRKGSAKVLVNFDDFSPSHMQSADKQEVVNNNGKGGLGNFPICGKEVPRGYWIFCRGSKNDTRGFSCGLWVLLHSLSVRIDDGESQFTFTAVCDFIHNFFVCEECRQHFYQMCSSVTSPFNKTRDFALWLWSTHNQVNERLMKLEASLKTGDPKFPKIIWPPKQLCSSCYRSHHHGDMKFRQIDWDQDEVFKFLTNYYGNTLVSLYKDREFLRNDGIDGALEDLVVSTNAVVVPVGAALAIALASCAFGALACYWRSQQKNRKPRRSWN
cccccccHHHHHHHHcccccccccEEEEEEEEccccccHHHHcccccccccEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHcccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHcccccccccccccccccccccEEcccccccccccccHHHHHHHHHHccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccc
**NYKPQYEKVARLFNGPNAAHPGIILMTRVDCALKINTNLCDKFSVGHYPMLLWGSPSKFVAGSWEP****KEIRALEDWQTADGLLTWINKQ*************NE**PSNISDPGQIARAVYDVEEATTTAFDIILDHKMIKSETRASLIRFLQVLVAHHPSRRCRKGSAKVLVNFDDFSPSHMQSADKQEVVNNNGKGGLGNFPICGKEVPRGYWIFCRGSKNDTRGFSCGLWVLLHSLSVRIDDGESQFTFTAVCDFIHNFFVCEECRQHFYQMCSSVTSPFNKTRDFALWLWSTHNQVNERLMKLEA*LKTGDPKFPKIIWPPKQLCSSCYRSHHHGDMKFRQIDWDQDEVFKFLTNYYGNTLVSLYKD*****************VSTNAVVVPVGAALAIALASCAFGALACYWRS************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRNYKPQYEKVARLFNGPNAAHPGIILMTRVDCALKINTNLCDKFSVGHYPMLLWGSPSKFVAGSWEPNQEKKEIRALEDWQTADGLLTWINKQTSRSYGLDDEKFENEQLPSNISDPGQIARAVYDVEEATTTAFDIILDHKMIKSETRASLIRFLQVLVAHHPSRRCRKGSAKVLVNFDDFSPSHMQSADKQEVVNNNGKGGLGNFPICGKEVPRGYWIFCRGSKNDTRGFSCGLWVLLHSLSVRIDDGESQFTFTAVCDFIHNFFVCEECRQHFYQMCSSVTSPFNKTRDFALWLWSTHNQVNERLMKLEASLKTGDPKFPKIIWPPKQLCSSCYRSHHHGDMKFRQIDWDQDEVFKFLTNYYGNTLVSLYKDREFLRNDGIDGALEDLVVSTNAVVVPVGAALAIALASCAFGALACYWRSQQKNRKPRRSWN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Sulfhydryl oxidase 1 Catalyzes the oxidation of sulfhydryl groups in peptide and protein thiols to disulfides with the reduction of oxygen to hydrogen peroxide. May contribute to disulfide bond formation in a variety of secreted proteins.probableQ6AUC6
Sulfhydryl oxidase 1 Sulfhydryl oxidase involved in the regulation of cation homeostasis. Positively regulates shoot accumulation of K(+) and inhibits accumulation of toxic cations. Acts at the level of root K(+) efflux systems involved in xylem loading (root symplast-xylem interface).probableQ8W4J3

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.8.-.-Acting on a sulfur group of donors.probable
1.8.3.-With oxygen as acceptor.probable
1.8.3.2Thiol oxidase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3T58, chain A
Confidence level:very confident
Coverage over the Query: 2-372
View the alignment between query and template
View the model in PyMOL
Template: 3QCP, chain A
Confidence level:very confident
Coverage over the Query: 2-380
View the alignment between query and template
View the model in PyMOL
Template: 2JWA, chain A
Confidence level:probable
Coverage over the Query: 424-431
View the alignment between query and template
View the model in PyMOL