Citrus Sinensis ID: 013744


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------
MSDGQETDKNIEIWKIKKLIKALESARGNGTSMISLIMPPRDQISRVTKMLGDEFGTASNIKSRVNRQSVLAAITSAQQRLKLYNKVPPNGLVLYTGTVVTDDGKEKKVTIDFEPFKPINASLYLCDNKFHTEALNELLESDDKFGFIVMDGNGTLFGTLSGNTREVLHKFTVDLPKKHGRGGQSALRFARLRMEKRHNYVRKTAELATQFFINPATSQPNVSGLILAGSADFKTELSQSDMFDPRLQAKILNVVDVSYGGENGFNQAIELSAEILSNVKFIQEKRLIGKYFEEISQDTGKYVFGVDDTLKALELGAVEILIVWENLDINRYVLKNSATGEIVIKHLNRDQEADQSNFRDAATSAELEVQEKTSLLEWFANEYKQFGCTLEFVTNKSQEGSQFCRGFGGIGGILRYQLDIRSYDELSDDGGVYEDSD
cccccccccHHHHHHHHHHHHHHHcccccccEEEEEEccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHcccccccCEEEEEEEEEcccccEEEEEEEcccccccccccccccccccHHHHHHHHHccccEEEEEECcccEEEEEEEccEEEEEEEEEECcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEccccHHHHHHHccccccHHHHccccEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEcHHHHHHHHHcccccEEEEEccccccEEEEEccccccEEEEEEcccccccccccccccccccHHHHHHccHHHHHHHHHHHcccEEEEEccccccHHHHHHccccEEEEEEEccccccccccccccccccccc
**********IEIWKIKKLIKALESARGNGTSMISLIMPPRDQISRVTKMLGDEFGTA*NIKSRVNRQSVLAAITSAQQRLKLYNKVPPNGLVLYTGTVVTDDGKEKKVTIDFEPFKPINASLYLCDNKFHTEALNELLESDDKFGFIVMDGNGTLFGTLSGNTREVLHKFTVDLPKKH****QSALRFARLRMEKRHNYVRKTAELATQFFINPATSQPNVSGLILAGSADFKTELSQSDMFDPRLQAKILNVVDVSYGGENGFNQAIELSAEILSNVKFIQEKRLIGKYFEEISQDTGKYVFGVDDTLKALELGAVEILIVWENLDINRYVLKNSATGEIVIKHLNRD********RDAATSAELEVQEKTSLLEWFANEYKQFGCTLEFVTNKSQEGSQFCRGFGGIGGILRYQLDIRSYDE*SD*********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDGQETDKNIEIWKIKKLIKALESARGNGTSMISLIMPPRDQISRVTKMLGDEFGTASNIKSRVNRQSVLAAITSAQQRLKLYNKVPPNGLVLYTGTVVTDDGKEKKVTIDFEPFKPINASLYLCDNKFHTEALNELLESDDKFGFIVMDGNGTLFGTLSGNTREVLHKFTVDLPKKHGRGGQSALRFARLRMEKRHNYVRKTAELATQFFINPATSQPNVSGLILAGSADFKTELSQSDMFDPRLQAKILNVVDVSYGGENGFNQAIELSAEILSNVKFIQEKRLIGKYFEEISQDTGKYVFGVDDTLKALELGAVEILIVWENLDINRYVLKNSATGEIVIKHLNRDQEADQSNFRDAATSAELEVQEKTSLLEWFANEYKQFGCTLEFVTNKSQEGSQFCRGFGGIGGILRYQLDIRSYDELSDDGGVYEDSD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Eukaryotic peptide chain release factor subunit 1-3 Directs the termination of nascent peptide synthesis (translation) in response to the termination codons UAA, UAG and UGA.confidentP35614
Eukaryotic peptide chain release factor subunit 1 Directs the termination of nascent peptide synthesis (translation) in response to the termination codons UAA, UAG and UGA (By similarity). Component of the transient SURF complex which recruits UPF1 to stalled ribosomes in the context of nonsense-mediated decay (NMD) of mRNAs containing premature stop codons.confidentQ8BWY3
Eukaryotic peptide chain release factor subunit 1 Directs the termination of nascent peptide synthesis (translation) in response to the termination codons UAA, UAG and UGA. Component of the transient SURF complex which recruits UPF1 to stalled ribosomes in the context of nonsense-mediated decay (NMD) of mRNAs containing premature stop codons.confidentQ5U2Q7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1DT9, chain A
Confidence level:very confident
Coverage over the Query: 4-359,371-423
View the alignment between query and template
View the model in PyMOL