Citrus Sinensis ID: 013749


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------
MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAINALQFYTNVQPTIRGRNVYVQFSSHQELTTMEQNAQGRGDEPNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQYQLRPSAVVARSSLQGRNIYDGCCQLDIQFSNLDELQVNYNNERSRDFTNPNLPAEQKGRPSQSGYSEAGVAFPQMANAAAIAAAFGGGLPPGITGTNDRCTVLVSNLNSDRIDEDKLFNLFSLYGNIIRIKLLRNKPDHALVQMGDGFQAELAVHFLKGALLFGKRLEVNFSKHPNITQGADTHEYMNSNLNRFNRNAAKNYRYCCSPTKMIHLSTLPQDVTEEEIVSHLEEHGSIVNTKLFEMNGKKQALVLFETEEQATEALVCKHASSLGGSIIRISFSQLQSIRENSQ
ccccccEEEEccccccccHHHHHHHHcccccEEEEEEEccccEEEEEcccHHHHHHHHHHHcccccEEccCEEEEEEccccccccccccccccccccccEEEEEEccccccccHHHHHHHccccccEEEEEEEEccccEEEEEccccHHHHHHHHHHcccccccccccEEEEEEccccHHHccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccEEEEEccccccccHHHHHHHHcccccEEEEEEcccccccEEEccccHHHHHHHHHHHccccccccEEEEEcccccccccccccccccccccccccccccccccccccccCEEEEccccccccHHHHHHHHHccccEEEEEEEECcccEEEEEEcccHHHHHHHHHHHccccccccEEEEEEccccccccccc
*TEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAINALQFYTNVQPTIRGRNVYVQFSSHQEL**********GDEPNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQYQLRPSAVVARSSLQGRNIYDGCCQLDIQFSNLDELQVNYNNERSRDFTNPN****************AGVAFPQMANAAAIAAAFGGGLPPGITGTNDRCTVLVSNLNSDRIDEDKLFNLFSLYGNIIRIKLLRNKPDHALVQMGDGFQAELAVHFLKGALLFGKRLEVNFSKHPNITQGADTHEYMNSNLNRFNRNAAKNYRYCCSPTKMIHLSTLPQDVTEEEIVSHLEEHGSIVNTKLFEMNGKKQALVLFETEEQATEALVCKHASSLGGSIIRISF***********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTEPSKVIHVRNVGHEISENDLLQLFQPFGVITKLVMLRAKNQALLQMQDVPSAINALQFYTNVQPTIRGRNVYVQFSSHQELTTMEQNAQGRGDEPNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQYQLRPSAVVARSSLQGRNIYDGCCQLDIQFSNLDELQVNYNNERSRDFTNPNLPAEQKGRPSQSGYSEAGVAFPQMANAAAIAAAFGGGLPPGITGTNDRCTVLVSNLNSDRIDEDKLFNLFSLYGNIIRIKLLRNKPDHALVQMGDGFQAELAVHFLKGALLFGKRLEVNFSKHPNITQGADTHEYMNSNLNRFNRNAAKNYRYCCSPTKMIHLSTLPQDVTEEEIVSHLEEHGSIVNTKLFEMNGKKQALVLFETEEQATEALVCKHASSLGGSIIRISFSQLQSIRENSQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Polypyrimidine tract-binding protein homolog 3 Plays a role in pre-mRNA splicing. Binds to the polypyrimidine tract of introns. May promote the binding of U2 snRNP to pre-mRNA.confidentQ6ICX4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3TYT, chain A
Confidence level:very confident
Coverage over the Query: 243-427
View the alignment between query and template
View the model in PyMOL
Template: 3ZZY, chain A
Confidence level:very confident
Coverage over the Query: 97-201
View the alignment between query and template
View the model in PyMOL
Template: 3PGW, chain A
Confidence level:very confident
Coverage over the Query: 101-188
View the alignment between query and template
View the model in PyMOL
Template: 2ADC, chain A
Confidence level:very confident
Coverage over the Query: 2-177
View the alignment between query and template
View the model in PyMOL