Citrus Sinensis ID: 013773


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430------
MALLNIGADNRGDAFYRYKMPKMITKIEGRGNGIKTNIVNMVDIAKALARPASYTTKYFGCELGAQSKFDEKTGTSLVNGSHDTAKLAGLLENFIKKYVQCYGCGNPETEIIITKTQMIQLKCAACGFVSDVDMRDKLNTFILKNPPESKKASKGKKAMRRAEKERLKEGEAADEELKKIKKEVKKKASSSKDGTTKATSSRRKANVSDEDHSSPPHGKEEVDDDVQWQTDTSLEAARQRIQEQLSAATADMVMLSTDESENKAKATSKAVSSPKGSHAENGNSQSHENLVDELKANLQKSITGMQLQTILGSLSGSAQEKMTALFEALFDGVEKGFSKEVVKKKNFLGAAVAEDEGLQLLLLRAIEAFCGKSSSYATKEVALVLKALYDSDVLEEEYIVQWYQEGLKGGSKNSQIWKNAKPFIEWLQSAESESEE
cccccccccccccccccccccccEEEEECcccccEEEEEEHHHHHHHHcccccHHHHHHHHHccccccccccccCEEECccccHHHHHHHHHHHHHHccccccccccccEEEEEcccEEEEEccccccccccccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccccccc
*****IGADNRGDAFYRYKMPKMITKIEGRGNGIKTNIVNMVDIAKALARPASYTTKYFGCELGAQSKFDEKTGTSLVNGSHDTAKLAGLLENFIKKYVQCYGCGNPETEIIITKTQMIQLKCAACGFVSDVDMRDKLNTFIL************************************************************************************WQTDTSL**********************************KAVSS***************NLVDELKANLQKSITGMQLQTILGSLSGSAQEKMTALFEALFDGVEKGFSKEVVKKKNFLGAAVAEDEGLQLLLLRAIEAFCGKSSSYATKEVALVLKALYDSDVLEEEYIVQWYQEGLKGGSKNSQIWKNAKPFIEWL**A******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALLNIGADNRGDAFYRYKMPKMITKIEGRGNGIKTNIVNMVDIAKALARPASYTTKYFGCELGAQSKFDEKTGTSLVNGSHDTAKLAGLLENFIKKYVQCYGCGNPETEIIITKTQMIQLKCAACGFVSDVDMRDKLNTFILKNPPESKKASKGKKAMRRAEKERLKEGEAADEELKKIKKEVKKKASSSKDGTTKATSSRRKANVSDEDHSSPPHGKEEVDDDVQWQTDTSLEAARQRIQEQLSAATADMVMLSTDESENKAKATSKAVSSPKGSHAENGNSQSHENLVDELKANLQKSITGMQLQTILGSLSGSAQEKMTALFEALFDGVEKGFSKEVVKKKNFLGAAVAEDEGLQLLLLRAIEAFCGKSSSYATKEVALVLKALYDSDVLEEEYIVQWYQEGLKGGSKNSQIWKNAKPFIEWLQSAESESEE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Eukaryotic translation initiation factor 5 Catalyzes the hydrolysis of GTP bound to the 40S ribosomal initiation complex (40S.mRNA.Met-tRNA[F].eIF-2.GTP) with the subsequent joining of a 60S ribosomal subunit resulting in the release of eIF-2 and the guanine nucleotide. The subsequent joining of a 60S ribosomal subunit results in the formation of a functional 80S initiation complex (80S.mRNA.Met-tRNA[F]).probableP48724
Probable eukaryotic translation initiation factor 5-1 Catalyzes the hydrolysis of GTP bound to the 40S ribosomal initiation complex (40S.mRNA.Met-tRNA[F].eIF-2.GTP) with the subsequent joining of a 60S ribosomal subunit resulting in the release of eIF-2 and the guanine nucleotide. The subsequent joining of a 60S ribosomal subunit results in the formation of a functional 80S initiation complex (80S.mRNA.Met-tRNA[F]).probableQ9C8F1
Probable eukaryotic translation initiation factor 5 Catalyzes the hydrolysis of GTP bound to the 40S ribosomal initiation complex (40S.mRNA.Met-tRNA[F].eIF-2.GTP) with the subsequent joining of a 60S ribosomal subunit resulting in the release of eIF-2 and the guanine nucleotide. The subsequent joining of a 60S ribosomal subunit results in the formation of a functional 80S initiation complex (80S.mRNA.Met-tRNA[F]).probableQ09689

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2G2K, chain A
Confidence level:very confident
Coverage over the Query: 1-152
View the alignment between query and template
View the model in PyMOL
Template: 2IU1, chain A
Confidence level:very confident
Coverage over the Query: 286-435
View the alignment between query and template
View the model in PyMOL