Citrus Sinensis ID: 013799


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430------
MSDSKLFVFGSFTEEETRSWLQSQSSGSVKKPVSSRRAEKPAEDKELQFGSLNFGTESSLVGTTDEPNGKSVVDGPVVFQPSTLLKKDDKVKSVGASNDHDLGAVGCPKENGHIKNSTNGPALSNGVNHLKADGIDFSSFHQNAGGHANPSPISKFHVLCDGNIDGRDQNAAACNSSISGSKEVPMKAINEPVKSVKDLLPRGLINSGNLCFLNATLQALMSCSPFVQLLQELRTRDIPKAGYPTLTAFVGFVSDFDTPSGGSSKKKNISVLDIGRPFSPSMFEAVLKNFTPDVPNSISGRPRQEDAQEFLSFIMDQMHDELLKLQGESTSINGANTALVSLAEEDEWETVGPKNKSAVTRTQSFLPSALSDIFGGQLKSVVKAQGNKASATVQPFLLLHLDIYSEAVHTIEDALRLFSAPENLEGYRTSSTGNVQ
cccccEEEECccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccCCcccccccccHHHHccccHHHHHHHHHHccccccccccHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHccccccccEEEccccccccccccccEEEccEEEcccccccEEEcccccEEEEccccccccHHHHHHHcccccCCcccccccccccc
***SKLFVFGSF*****************************************************************************************************************************************************************************************DLLPRGLINSGNLCFLNATLQALMSCSPFVQLLQELRTRDIPKAGYPTLTAFVGFVSDFDTPSG********SVLDIGRPFSPSMFEAVLKNFTPDVPN*IS**PRQEDAQEFLSFIMDQMHDELLK*************ALV**********VGPKNKSAVTRTQSFLPSALSDIFGGQLKSVVKAQGNKASATVQPFLLLHLDIYSEAVHTIEDALRLFSAPENLEGYRTSSTG***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDSKLFVFGSFTEEETRSWLQSQSSGSVKKPVSSRRAEKPAEDKELQFGSLNFGTESSLVGTTDEPNGKSVVDGPVVFQPSTLLKKDDKVKSVGASNDHDLGAVGCPKENGHIKNSTNGPALSNGVNHLKADGIDFSSFHQNAGGHANPSPISKFHVLCDGNIDGRDQNAAACNSSISGSKEVPMKAINEPVKSVKDLLPRGLINSGNLCFLNATLQALMSCSPFVQLLQELRTRDIPKAGYPTLTAFVGFVSDFDTPSGGSSKKKNISVLDIGRPFSPSMFEAVLKNFTPDVPNSISGRPRQEDAQEFLSFIMDQMHDELLKLQGESTSINGANTALVSLAEEDEWETVGPKNKSAVTRTQSFLPSALSDIFGGQLKSVVKAQGNKASATVQPFLLLHLDIYSEAVHTIEDALRLFSAPENLEGYRTSSTGNVQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ubiquitin carboxyl-terminal hydrolase 24 Recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ubiquitin. Involved in the processing of poly-ubiquitin precursors as well as that of ubiquitinated proteins.probableQ9FPS3

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.4.-.-Acting on peptide bonds (peptide hydrolases).probable
3.4.19.-Omega peptidases.probable
3.4.19.12Ubiquitinyl hydrolase 1.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3I3T, chain A
Confidence level:very confident
Coverage over the Query: 201-260,274-325,338-356,368-436
View the alignment between query and template
View the model in PyMOL
Template: 2HD5, chain A
Confidence level:probable
Coverage over the Query: 203-325,342-426
View the alignment between query and template
View the model in PyMOL